PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0382s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 407aa    MW: 44929.5 Da    PI: 7.3838
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0382s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.2e-40172249178
                             --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                     SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                             +Cqv gC++ l +ak+yhrrhkvCe hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  SapurV1A.0382s0120.1.p 172 RCQVVGCNVALLNAKDYHRRHKVCELHSKAPKVIVLGLEQRFCQQCSRFHLVSEFDNAKRSCRRRLAGHNERRRKSSQ 249
                             6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.2E-34166234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.864170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.06E-37171252IPR004333Transcription factor, SBP-box
PfamPF031101.9E-31173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MENGGNKGQE NDHANLSWDI WELNTSRFDL VNGSNSTAAT DTFFTTTATS MVESGSPCTH  60
PEGSSAHGFL FPYQNSWLYH QSSNNSYQQL SLYAGDGSNL PPDPHPMCLK LGKRHYFENS  120
TSNNSHNNHP VSDRHEVGGF SIGKRGKPYY SVGGGGGDHD GPSSSTSVTV PRCQVVGCNV  180
ALLNAKDYHR RHKVCELHSK APKVIVLGLE QRFCQQCSRF HLVSEFDNAK RSCRRRLAGH  240
NERRRKSSQD SVSRNSSQDK VIAGRFPYIA SPTGCALSLL SSKSDSWVSP SDLSSRSSAA  300
LRELIAENRA AILSRQVFLQ KHLHHHTMED PGESHPLSNF LTTHQQQVLS EPHDWSRLND  360
TSTHVTLDLM QAPSSAFGFL SPRGKNKEEE DECSELWSTL EGAHVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30164246284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0382s0120.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375256.10.0squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ7XT423e-60SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLU5FPG50.0U5FPG5_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-35squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]