PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0379s0100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GATA
Protein Properties Length: 330aa    MW: 36697.8 Da    PI: 7.1806
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0379s0100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18248281134
                    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                             Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  SapurV1A.0379s0100.1.p 248 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 281
                             *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-825326IPR016679Transcription factor, GATA, plant
SuperFamilySSF577163.33E-14241304No hitNo description
SMARTSM004014.4E-14242296IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.385242278IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-14246279IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.89E-14247304No hitNo description
PfamPF003204.1E-16248281IPR000679Zinc finger, GATA-type
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEFRMEARAL KSSLRGELET ESTSQQDFSE DFLVFNTPSV VSSDQDFSVD CFLDFSNGEF  60
KDGYVQEEEE EKDSISVSSQ DRVDDDFNSN SSSFSDSFLA SELAVPSDDI AELEWVSHFV  120
DDSVSDVSLL VPAFKGSPKR HANNRLEPET KPTFAKTPCF FPSRVPSKAR TKRSGHASRT  180
WSAGPNRSET PSSSTSSTSS MPCLVATNMV QTADSLSWLS EQPMKKTKKR PAVHTRGLMA  240
STQFQRRCSH CQVQKTPQWR TGPLGAKTLC NACGVRYKSG RLFPEYRPAC SPTFSSEVHS  300
NSHRKVVEMR RKKEVAGAEP RLSHMVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313763.20.0hypothetical protein POPTR_0009s12620g
TrEMBLB9HRG70.0B9HRG7_POPTR; Uncharacterized protein
STRINGPOPTR_0009s12620.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-51GATA transcription factor 5