PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0347s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARR-B
Protein Properties Length: 684aa    MW: 74925.4 Da    PI: 5.9889
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0347s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.2e-28208261155
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             kpr++W+ eLH++Fv+av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  SapurV1A.0347s0250.1.p 208 KPRVVWSVELHQKFVSAVNQL-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 261
                             79*******************.********************************8 PP

2Response_reg85.91.2e-28231311109
                             EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
            Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                             vl vdD+p+ +++l ++l+k +y ev+++ ++  alell+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e 
  SapurV1A.0347s0250.1.p  23 VLAVDDDPICLKVLDNLLRKCQY-EVTTTNQAVTALELLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEF 107
                             799********************.***************999889*******************87754.558************** PP

                             HHHHHHTTESEEEESS--HHHHHH CS
            Response_reg  86 alealkaGakdflsKpfdpeelvk 109
                             + + +  Ga d+l Kp+  eel +
  SapurV1A.0347s0250.1.p 108 VYKGITHGAVDYLLKPVRLEELKN 131
                             *********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.1E-1631683IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.7E-4220154No hitNo description
SuperFamilySSF521721.22E-3620146IPR011006CheY-like superfamily
SMARTSM004484.6E-3521133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.45322137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2523131IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.56E-3024137No hitNo description
PROSITE profilePS5129412.608205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-30205266IPR009057Homeodomain-like
SuperFamilySSF466892.33E-19206265IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-24208261IPR006447Myb domain, plants
PfamPF002491.9E-7210259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MTVEDQRGGN SANEKMFPVG MRVLAVDDDP ICLKVLDNLL RKCQYEVTTT NQAVTALELL  60
RENRNKYDLV ISDVNMPDMD GFKLLELVGL EMDLPVIMLS SHGDKEFVYK GITHGAVDYL  120
LKPVRLEELK NIWQHVIRRK KWYPQDQNRS PNRDKGGDGA GEGEQGATSN GSGDQNGKGN  180
RKRKDQDEED EGEGEDGNEN EESGNQKKPR VVWSVELHQK FVSAVNQLGL DKAVPKKILD  240
LMNVDGLTRE NVASHLQKFR LYLKRLSCGA NQQPNMVAAF GAKDSSYLRM GSLDGFGDFC  300
SVHGSGQLSA TSLSSYPPGS LLGRLNSPGG LTLHGASSAL LQSGHSRSLN NSLNTLGKLQ  360
PGLVQTNRGS TSLFQGISSA LEPKPSQFKS MNHFGDFNGK GDATSFTIAS CFPDVKVTIG  420
GLSNTISCAT NNPQMLHVNP QQIQTRRSLA TQSSLSMPSL NQESFDVGVR GSSNFLDHSR  480
CDNNWQGAVQ LSTFPSNSLP LGEPFRHDPL PTSTRRDNIS STTSHIVNPL DFSSSGSLTV  540
PLDMQGQADL VGNIFHNTNY TSKNRWGESS HNYNPCLNGS FGSMSQSMEQ RKRFDASVLG  600
QSNSGTQSMF QHLEAENSAL DPKMRSNEEF LLEQTKPPNG FVQNNYDSLD DMVNAMIKRQ  660
DQNDGILMDG EFGFESYSPG SCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26206267364ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0347s0250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081420.0FN908142.1 Populus x canadensis mRNA for putative B-type response regulator 19 (rr19 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017979.10.0PREDICTED: two-component response regulator ARR12 isoform X1
TrEMBLB9IMH10.0B9IMH1_POPTR; Uncharacterized protein
STRINGPOPTR_0018s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.11e-115response regulator 18