PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0333s0300.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 27128 Da    PI: 7.853
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0333s0300.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.71.1e-261059251
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            rien++ rqvtfskRr+g+lKK +ELSvLCda++ +i+fsstgkl  y++
  SapurV1A.0333s0300.4.p 10 RIENQTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIVFSSTGKLCQYCT 59
                            8***********************************************96 PP

2K-box65.12.5e-22811701099
                   K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                             e+   e+l  ela L+ke+  Lq++ R++  ed++++ ++eL  +eqqLe+s++k+R++Kn+ll++q+e+l++ke++l+ee  ++ +
  SapurV1A.0333s0300.4.p  81 EHDSREQLFGELAMLRKETLLLQSNMRRYTCEDMSPIPFEELDAIEQQLERSVNKVRDRKNQLLHQQLENLRRKERMLEEESSNMYR 167
                             4455677888***********************************************************************998877 PP

                   K-box  97 kle 99 
                              ++
  SapurV1A.0333s0300.4.p 168 WIQ 170
                             665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.109161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-30277IPR002100Transcription factor, MADS-box
CDDcd002651.92E-41276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2181169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.13885175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIAIRR IENQTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIVFSS TGKLCQYCTE  60
GLRMEQIIER YQKMTGTCIP EHDSREQLFG ELAMLRKETL LLQSNMRRYT CEDMSPIPFE  120
ELDAIEQQLE RSVNKVRDRK NQLLHQQLEN LRRKERMLEE ESSNMYRWIQ EHRAALGYQQ  180
AAIEVKPAEH QQVLDQFPFC GEPSSVLQLS NITHQIDPYH LQLAQPSLQG SNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A9e-19171169MEF2C
5f28_B9e-19171169MEF2C
5f28_C9e-19171169MEF2C
5f28_D9e-19171169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0333s0300.4.p
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166828e-77AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022027.11e-152PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1
RefseqXP_011022028.11e-152PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1
SwissprotQ8RYD91e-88TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLA0A2K1ZQP21e-150A0A2K1ZQP2_POPTR; Uncharacterized protein
STRINGXP_002513703.11e-138(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.26e-91MIKC_MADS family protein
Publications ? help Back to Top
  1. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  2. Rhodes DH, et al.
    Genome-wide association study of grain polyphenol concentrations in global sorghum [Sorghum bicolor (L.) Moench] germplasm.
    J. Agric. Food Chem., 2014. 62(45): p. 10916-27
    [PMID:25272193]
  3. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  4. Ehlers K, et al.
    The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana.
    PLoS ONE, 2016. 11(10): p. e0165075
    [PMID:27776173]
  5. Coen O, et al.
    Developmental patterning of the sub-epidermal integument cell layer in Arabidopsis seeds.
    Development, 2017. 144(8): p. 1490-1497
    [PMID:28348169]
  6. Xu W, et al.
    TRANSPARENT TESTA 16 and 15 act through different mechanisms to control proanthocyanidin accumulation in Arabidopsis testa.
    J. Exp. Bot., 2017. 68(11): p. 2859-2870
    [PMID:28830101]
  7. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Developmental patterning of sub-epidermal cells in the outer integument of Arabidopsis seeds.
    PLoS ONE, 2017. 12(11): p. e0188148
    [PMID:29141031]