PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0329s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 542aa    MW: 59318.8 Da    PI: 8.5259
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0329s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.91.9e-40176251277
                             -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                     SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                             Cqv +C++dls+ k+yh+rhkvCevhsk+++v+v+g+e+rfCqqCsrfh lsefD++krsCr+rLa+hne rrk+q
  SapurV1A.0329s0040.1.p 176 CQVYDCNKDLSSSKQYHKRHKVCEVHSKTAKVIVNGIEKRFCQQCSRFHLLSEFDDSKRSCRKRLAGHNEWRRKPQ 251
                             **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-32170237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.077173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37174253IPR004333Transcription factor, SBP-box
PfamPF031104.0E-30176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MESGSYVLGG KGHVSIGATS SSDIFSRSKY VLMSCNLKNQ SNFEYDCLVS GSQAIENGAR  60
RELGYQQLIE KHEPDTSIRD ALTSKVSCRK NTNSFMVTPN SFTLEDESTS RLSSTVMESD  120
CRVSAFIDLN LGRFGDPRDV QNCRRISKSA SIVFPSESSA PPRSYRAGMN SHTAYCQVYD  180
CNKDLSSSKQ YHKRHKVCEV HSKTAKVIVN GIEKRFCQQC SRFHLLSEFD DSKRSCRKRL  240
AGHNEWRRKP QAGLQSGRTG RLFHSYSGFS SSRTHGNALT TASFICQDVL QSGLSHPNKY  300
GANGWCKRVK IEDGTGSPPS SIPITNAYLH SKSLFPSNNF EKIFPTFHEV GANTASGSIL  360
NESTDRYQDV MGGKTSSSHS FLQDTSLVNN ELTAFDAAST IQELSGTTTS GCAHSLLSSQ  420
SQNSSSHSSG IPMYHQLIVS CRNTGNSMDQ IIGASSQASS SEVPNKFPSW VTSSVKGSHL  480
GPLLISGNSH VVNFDVTDGV YHGSHFLNAR DHLGSEDDTT TDLLQLPSQP QRVQQCKQNR  540
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281762491184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0329s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374432.10.0squamosa promoter-binding-like protein 18
TrEMBLA0A385JIN00.0A0A385JIN0_POPTO; Squamosa promoter-binding protein-like
TrEMBLU5FPU60.0U5FPU6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-39SBP family protein