PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0326s0130.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 475aa    MW: 52350.3 Da    PI: 7.8582
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0326s0130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.4e-24175217244
                     WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                              epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  SapurV1A.0326s0130.1.p 175 LEPGRCRRTDGKKWRCSREVAPDQKYCERHMHRGRPRSRKHVE 217
                             69***************************************97 PP

2QLQ49.51.3e-17125156233
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33 
                             +FT+aQ+ +L++Q+++yKy++++  vPp+Ll 
  SapurV1A.0326s0130.1.p 125 PFTNAQWKELERQAMIYKYMVSSIHVPPHLLI 156
                             8*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-8124160IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.9E-12125157IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.593125160IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.596174218IPR014977WRC domain
PfamPF088791.6E-20176217IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MRINYGFDVP NKAAKERKMT SDVDFGVKLR QPIDHHQSFP FSRTPMMVLH ANQHRPFDNG  60
PTSSCDGNKP LINYSGDHIY SGGACCAAVG VRTLQPFETS ETTTTTTASA FKSPGGNMAA  120
SLGFPFTNAQ WKELERQAMI YKYMVSSIHV PPHLLIPPPI MGNGLDVGFT NRADLEPGRC  180
RRTDGKKWRC SREVAPDQKY CERHMHRGRP RSRKHVELNS SNKKSRNNPA ICTEFPVTAA  240
ISNSTIKDNH SGSASDEQFV RTTMPQPYIQ APVSVNKSSE KISTFDVDRT FGSTYREPRS  300
SDWMLEGGTV PIVTNDQQWP HLVRTKIGIA IEGSLNDASV LKQHYREESL NLNSFGNFNA  360
RENQHSNQNS LFLDESPSGF IDAWSTDANS GNTSSVSSDG KLPLSHLSLS MGGNRSIDDE  420
MGQIQMNLGL IGQYQNQECG GDTSSTPGGP LAEVLQLRTV NINTGTNHQS PFHN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0326s0130.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321965.20.0growth-regulating factor 4
TrEMBLA0A3N7G3550.0A0A3N7G355_POPTR; Uncharacterized protein
STRINGPOPTR_0015s00860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.13e-32growth-regulating factor 7