PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0323s0180.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 29519.4 Da    PI: 6.8024
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0323s0180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.78.4e-30959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krienk+nrqvtfskRr+g+lKKA+E+SvLCda+va+i+fs++gk+ eys+
  SapurV1A.0323s0180.1.p  9 KRIENKINRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTRGKISEYST 59
                            79***********************************************96 PP

2K-box90.92.2e-30751741100
                   K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                             yq+++ + + ++++es++ ++ kL +++e Lqr++R++ G++L+sL+lkeLq Leqq++++lk+iRs+K++ll+e+++el+kkekel
  SapurV1A.0323s0180.1.p  75 YQEQQLVPNGSEHQESWSLDHPKLMARVEILQRNLRNYTGQELDSLNLKELQYLEQQIDTALKRIRSRKSQLLHESLNELRKKEKEL 161
                             7889999999***************************************************************************** PP

                   K-box  88 qeenkaLrkklee 100
                             qe+n  L+++++e
  SapurV1A.0323s0180.1.p 162 QEQNSILEEQVKE 174
                             *********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.525161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-32289IPR002100Transcription factor, MADS-box
CDDcd002651.70E-39279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2484172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.13388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRTGLLK KAHEISVLCD ADVALIVFST RGKISEYSTD  60
SSMESILERY ERCSYQEQQL VPNGSEHQES WSLDHPKLMA RVEILQRNLR NYTGQELDSL  120
NLKELQYLEQ QIDTALKRIR SRKSQLLHES LNELRKKEKE LQEQNSILEE QVKENEKSLT  180
EQAQWEQLNL GQNSSSFMPP VVQPPLQPPM PSHPPLTIGD SFRSIGFLNG DENAEVQTQP  240
STMPPWMLRH VNDTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-18170169MEF2C
5f28_B1e-18170169MEF2C
5f28_C1e-18170169MEF2C
5f28_D1e-18170169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0323s0180.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2083772e-84AC208377.1 Populus trichocarpa clone JGIACSB249-L10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306050.31e-159truncated transcription factor CAULIFLOWER A
SwissprotD7SMN65e-97FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A2K2AT731e-158A0A2K2AT73_POPTR; Uncharacterized protein
STRINGEOY037921e-108(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.12e-74AGAMOUS-like 8
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]