PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0323s0170.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 28317.2 Da    PI: 8.5901
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0323s0170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-31959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  SapurV1A.0323s0170.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCS 59
                            79***********************************************96 PP

2K-box95.11.1e-31811738100
                   K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                             ++ +++ e++++e+ k+k++ e Lqr+qR++lGedL++L+ keL+qLe+qLe+sl+++Rs+K++++l+q+ +lq+ke++l e+n+ L
  SapurV1A.0323s0170.1.p  81 NKPAKELENSYREYLKVKARFEVLQRTQRNFLGEDLGPLNTKELEQLERQLESSLNQVRSTKTQFMLDQLADLQNKEHMLLEANRGL 167
                             4567889******************************************************************************** PP

                   K-box  95 rkklee 100
                             + kl+e
  SapurV1A.0323s0170.1.p 168 TIKLDE 173
                             999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.487161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-33275IPR002100Transcription factor, MADS-box
CDDcd002652.27E-45276No hitNo description
PRINTSPR004048.8E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-333859IPR002100Transcription factor, MADS-box
PfamPF014866.9E-2784171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.81487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLYEFCST  60
SNMLKTLERY QKCSYGVEET NKPAKELENS YREYLKVKAR FEVLQRTQRN FLGEDLGPLN  120
TKELEQLERQ LESSLNQVRS TKTQFMLDQL ADLQNKEHML LEANRGLTIK LDEISSRNSL  180
RPPWEGDDQQ NMSYGHHHAQ SQGLFQPLEC NPTLQIGYNQ VGSDQMTGTT QVTQQVHGFI  240
PGWML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A4e-34751711101Developmental protein SEPALLATA 3
4ox0_B4e-34751711101Developmental protein SEPALLATA 3
4ox0_C4e-34751711101Developmental protein SEPALLATA 3
4ox0_D4e-34751711101Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0323s0170.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ7893980.0DQ789398.1 Populus tomentosa MADS4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306051.21e-172developmental protein SEPALLATA 2
RefseqXP_006384290.11e-172developmental protein SEPALLATA 2
RefseqXP_011008140.11e-172PREDICTED: developmental protein SEPALLATA 2-like
RefseqXP_011008141.11e-172PREDICTED: developmental protein SEPALLATA 2-like
SwissprotQ8LLR21e-138MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLB9H0G01e-171B9H0G0_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_14.2221e-151(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-118MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]