PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0284s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 147aa    MW: 15971.3 Da    PI: 8.6098
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0284s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.41.7e-45131121100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l e++r+da+ss+vyeA+ar+rdPvyG++g i++lq+q+
  SapurV1A.0284s0080.1.p  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELAEHQRRDAVSSMVYEANARVRDPVYGCAGAISSLQKQI 99 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++l+++lal+++e
  SapurV1A.0284s0080.1.p 100 DSLQTQLALAQAE 112
                             ********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.85112113IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MKESGRKVGA VSPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LAEHQRRDAV SSMVYEANAR VRDPVYGCAG AISSLQKQID SLQTQLALAQ AEVVHMRMRQ  120
FSTSSSPGAM DRAVDQAAMG ESLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-5091147112LOB family transfactor Ramosa2.1
5ly0_B5e-5091147112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0284s0080.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030434.19e-98PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE91e-68LBD4_ARATH; LOB domain-containing protein 4
TrEMBLB9HGW42e-95B9HGW4_POPTR; Uncharacterized protein
STRINGPOPTR_0007s08290.13e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-71LOB domain-containing protein 4