PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0278s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family M-type_MADS
Protein Properties Length: 371aa    MW: 42448.3 Da    PI: 9.2519
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0278s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.42.1e-141152344
                            --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                  SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                            i n+  r+ tf kR++ +lKK +  S+LC+++++viif++++
  SapurV1A.0278s0250.1.p 11 IRNEKSRTHTFRKRKTNLLKKVSDFSILCGVDACVIIFGPNQ 52
                            899************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.404161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-13160IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-7323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-17493IPR002100Transcription factor, MADS-box
CDDcd002662.75E-18451No hitNo description
PfamPF003192.1E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MVNKRIEMEL IRNEKSRTHT FRKRKTNLLK KVSDFSILCG VDACVIIFGP NQNDQPAATA  60
ETWPSNPDEV RCIINRYKAS DQPRKCYQGS DYFAAKKKKI DAEFAKLHRQ VLKSKYPIWD  120
DRLNSLSIDQ LGVILAQMDT KIESTDKTLS FFKEYSSQRC QNISHGIQKR RKRNENSNEN  180
MDSTDFLQLV SNRKSFEAQL PIPFQPEMSS HMATPDENSL NERIYNNGYS TLYSEPKPLS  240
VFPPAHYESK QSVYRTPSQT NITEDAMMKM MMSYQSHNNS FGCQASSRNN QCLSCNGPFY  300
VNPASWTLDN VWFDNDDSTV SSVAPTMQPM QPYKQFPMTS FPMTSFLNSM VMLSLIVGIK  360
VKTRSGIVKI *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0278s0250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300109.10.0agamous-like MADS-box protein AGL103
TrEMBLA0A2K2C7C90.0A0A2K2C7C9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-25M-type_MADS family protein