PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0270s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 148aa    MW: 16910.7 Da    PI: 5.0025
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0270s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26023.91.2e-0735944100
                  DUF260  44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                             ++l++l  ++r + ++s+++eA ++ +d ++G +g +++l    +q+k e +ll+++
  SapurV1A.0270s0250.1.p   3 RMLRNLGVQDRANSVESIIWEATCWSKDSINGPLGCLKRLVDSERQAKLENQLLRKQ 59 
                             799999************************************999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-5355IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MERMLRNLGV QDRANSVESI IWEATCWSKD SINGPLGCLK RLVDSERQAK LENQLLRKQL  60
YSLSRSGRSA QIDEKQQNQT NEQMLNMEGS ASDQVYATPD SDIARNYYFD SEEGLELHWQ  120
GNIYTRYGSV NPQEIRGRKN FTDNASI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0270s0250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K1YGB58e-74A0A2K1YGB5_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0011s06000.12e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2806633