PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0252s0210.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family M-type_MADS
Protein Properties Length: 396aa    MW: 44509.4 Da    PI: 7.4942
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0252s0210.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF534.5e-171151343
                            --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                  SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                            i  +  r  tf kR++g+lKKA+E S+LC+++++viif+++
  SapurV1A.0252s0210.1.p 11 IRKEKSRMLTFRKRKAGLLKKASEFSILCGVDACVIIFGPK 51
                            56677899*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.857151IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-18166IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-19188IPR002100Transcription factor, MADS-box
CDDcd002662.58E-22270No hitNo description
PRINTSPR004041.6E-8323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGQKRIKMEL IRKEKSRMLT FRKRKAGLLK KASEFSILCG VDACVIIFGP KLKDDRQPIA  60
PETWPPNSEE VRCIINRYKD SDQPRRCYQV SDYFADKKKQ IDSELARLHR QIIKANLYAD  120
QLRVLAGQLD AKIDLADKKL GSFNVNQYAM GAPGVPAASL IPSVSHGMDS YMESRDDNFP  180
QLILDSKPFD AQPPMVFYPE QSSYMTNLLE RKHSNGYSTD LQVYHEPGPL NDQLPVHFQS  240
KQTSHGTAMS ASFWESNNGS CYSTDLQLYL EPNPLNVPPP LHFQPKQNAH RTSAYLHAME  300
DAIMKMACDQ NTSDQFGCKL SGGSNLPYVN CTPCMWDNVW FNNAGSSVSY IAPTRQPILP  360
SIQIPMSSFP HQMQSSEASD FTGNLEFEGK GQGYN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0252s0210.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2977060.0KC297706.1 Populus tomentosa AGL24 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301840.20.0MADS-box transcription factor 3
TrEMBLB9GRC00.0B9GRC0_POPTR; Uncharacterized protein
STRINGPOPTR_0002s25700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-24M-type_MADS family protein