PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0222s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 202aa    MW: 21561.5 Da    PI: 8.303
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0222s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.72.6e-40181171100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk++Gasnv+kll ++pe++r d+++slvyeA+ r+rdPvyG++g i++lqqq+
  SapurV1A.0222s0070.2.p  18 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVYGASNVSKLLMEVPESQRVDTANSLVYEANLRLRDPVYGSMGAISALQQQI 104
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++l+ael+++++e
  SapurV1A.0222s0070.2.p 105 QSLQAELSAIRAE 117
                             ********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.77417118IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4018115IPR004883Lateral organ boundaries, LOB
PfamPF053082.9E-799176IPR007972Mitochondrial fission regulator 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGRRQMLGPP VILNTVTPCA ACKLLRRRCA EECPFSPYFS PHEPQKFAAV HKVYGASNVS  60
KLLMEVPESQ RVDTANSLVY EANLRLRDPV YGSMGAISAL QQQIQSLQAE LSAIRAEILN  120
YKYREAAATN IISSTHPALV SSATVTISAP SQTLAPPPPP PPPPPPSVVV SSSSSSSLYT  180
PPTSTSGYST ISSDNNVPYF D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-421812511118LOB family transfactor Ramosa2.1
5ly0_B2e-421812511118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0222s0070.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707800.0AB970780.1 Populus tremula x Populus tremuloides PtxtLBD15a mRNA for LOB domain-containing protein 15, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319420.11e-121LOB domain-containing protein 15 isoform X1
SwissprotQ9AT611e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0E4B9M51e-120A0A0E4B9M5_POPPZ; LOB domain-containing protein 15
STRINGPOPTR_0013s15220.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-63LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]