PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0222s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 226aa    MW: 24439.7 Da    PI: 8.5926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0222s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.33.4e-40421411100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk++Gasnv+kll ++pe++r d+++slvyeA+ r+rdPvyG++g i++lqqq+
  SapurV1A.0222s0070.1.p  42 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVYGASNVSKLLMEVPESQRVDTANSLVYEANLRLRDPVYGSMGAISALQQQI 128
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++l+ael+++++e
  SapurV1A.0222s0070.1.p 129 QSLQAELSAIRAE 141
                             ********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.77441142IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-4042139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRDRERFEE LGKRIKRESD ASSLMGRRQM LGPPVILNTV TPCAACKLLR RRCAEECPFS  60
PYFSPHEPQK FAAVHKVYGA SNVSKLLMEV PESQRVDTAN SLVYEANLRL RDPVYGSMGA  120
ISALQQQIQS LQAELSAIRA EILNYKYREA AATNIISSTH PALVSSATVT ISAPSQTLAP  180
PPPPPPPPPP SVVVSSSSSS SLYTPPTSTS GYSTISSDNN VPYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-424214911118LOB family transfactor Ramosa2.1
5ly0_B4e-424214911118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0222s0070.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707800.0AB970780.1 Populus tremula x Populus tremuloides PtxtLBD15a mRNA for LOB domain-containing protein 15, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319420.11e-137LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T56e-79LBD15_ARATH; LOB domain-containing protein 15
TrEMBLB9I6X01e-136B9I6X0_POPTR; LBD family protein
STRINGPOPTR_0013s15220.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-75LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]