PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0217s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family M-type_MADS
Protein Properties Length: 337aa    MW: 38408.3 Da    PI: 9.1418
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0217s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.51.1e-151153345
                            --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                  SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                            i n++ r +t+ kR++g+ KKA E  +LC+++++vii++++++
  SapurV1A.0217s0080.1.p 11 ICNERSRMITYHKRKKGLTKKAREFQILCGVDACVIILGPKQN 53
                            7799***********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.801161IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-14164IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-18177IPR002100Transcription factor, MADS-box
CDDcd002664.42E-19286No hitNo description
PRINTSPR004041.9E-7323IPR002100Transcription factor, MADS-box
PfamPF003198.0E-181152IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRGKLTMEL ICNERSRMIT YHKRKKGLTK KAREFQILCG VDACVIILGP KQNNHPVDVE  60
TWPTDLVEVR RIINRFRSEG ADRKKTQDLS YFFEARKKKV DDEIAKLRKA CMQAKFPAWD  120
NRLNLLSLDQ LRELAGIFES KLDVARGWLL KLKGNPFSME DSESGINKSS LMACGNLANA  180
FLPKNIEFEG LNQQQPLPCA KPVDMSLATY YPSDQLQQML PFNGDPINSP MLMLMMNHED  240
FGQFGGLSSS SIMKSTVQYN YDPTAEMIGK MMMFNNPRAH SVSYHGPSRQ PVFPYRQGPM  300
VQNVSSQLCI PQFSYFSDAN EFEMSRKENL AMKTHY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18298RKKTQDLSYFFEARKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0217s0080.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1840820.0AC184082.2 Populus trichocarpa clone Pop1-55P2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044609.10.0PREDICTED: agamous-like MADS-box protein AGL19
TrEMBLA0A2K2C1G80.0A0A2K2C1G8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-24M-type_MADS family protein