PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0216s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 158aa    MW: 17297.7 Da    PI: 9.8905
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0216s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.93.1e-291580671
                     TCP  6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71
                            ++ +++  kv+gRdRR+Rl+++caar+F+L++eLG ++d++tieWLl+ a+p i++ tg+++ + s
  SapurV1A.0216s0030.1.p 15 RSRKDRRLKVNGRDRRIRLPMNCAARIFQLTRELGSKTDGETIEWLLRVAEPTIIAVTGNGAAATS 80
                            6789********************************************************554442 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.7E-251682IPR005333Transcription factor, TCP
PROSITE profilePS5136922.5261771IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MNNKSTSKIK VDDPRSRKDR RLKVNGRDRR IRLPMNCAAR IFQLTRELGS KTDGETIEWL  60
LRVAEPTIIA VTGNGAAATS VNTTMVPQPP GLHPSAGSAG LSSSNIYACE ARSTEPIQAR  120
GLNIKDKNCE VPENDPLVFP PGFDYLGTNF NREYLLK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0216s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314294.32e-55transcription factor TCP7
TrEMBLA0A2K1Z0T15e-54A0A2K1Z0T1_POPTR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.11e-27TCP family protein