PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0215s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 198aa    MW: 21042 Da    PI: 8.303
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0215s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.52.9e-40181171100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+kll ++pe++r da++slvyeA+ r+rdPvyG++g i++lqqq+
  SapurV1A.0215s0070.2.p  18 PCAACKLLRRRCAEECPFSPYFSPLEPQKFAAVHKVFGASNVSKLLMEVPESQRADAANSLVYEANLRLRDPVYGSMGAISALQQQI 104
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             + l+ael+++++ 
  SapurV1A.0215s0070.2.p 105 QLLQAELSATRAD 117
                             ********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37817118IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4018115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRRQMLGLP GILNTVTPCA ACKLLRRRCA EECPFSPYFS PLEPQKFAAV HKVFGASNVS  60
KLLMEVPESQ RADAANSLVY EANLRLRDPV YGSMGAISAL QQQIQLLQAE LSATRADILS  120
YKYREAAASN IISSTHAALV SSATISAPSQ TLAPPPPPPP PLSVVVSLSS SSPLYTPPTS  180
TSGYSTLSSE NNVPYFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-431812511118LOB family transfactor Ramosa2.1
5ly0_B5e-431812511118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0215s0070.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319420.11e-106LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T57e-67LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT617e-67LBD13_ARATH; LOB domain-containing protein 13
TrEMBLB9I6X01e-105B9I6X0_POPTR; LBD family protein
STRINGPOPTR_0013s15220.11e-106(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-62LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]