PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0215s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 222aa    MW: 23886.2 Da    PI: 8.5988
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0215s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.9e-40421411100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+kll ++pe++r da++slvyeA+ r+rdPvyG++g i++lqqq+
  SapurV1A.0215s0070.1.p  42 PCAACKLLRRRCAEECPFSPYFSPLEPQKFAAVHKVFGASNVSKLLMEVPESQRADAANSLVYEANLRLRDPVYGSMGAISALQQQI 128
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             + l+ael+++++ 
  SapurV1A.0215s0070.1.p 129 QLLQAELSATRAD 141
                             ********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37841142IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4042139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSRDRERIEE IGKRIKRESD ASSLMGRRQM LGLPGILNTV TPCAACKLLR RRCAEECPFS  60
PYFSPLEPQK FAAVHKVFGA SNVSKLLMEV PESQRADAAN SLVYEANLRL RDPVYGSMGA  120
ISALQQQIQL LQAELSATRA DILSYKYREA AASNIISSTH AALVSSATIS APSQTLAPPP  180
PPPPPLSVVV SLSSSSPLYT PPTSTSGYST LSSENNVPYF D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-424214911118LOB family transfactor Ramosa2.1
5ly0_B1e-424214911118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0215s0070.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371667.11e-124LOB domain-containing protein 15
SwissprotQ8L5T53e-78LBD15_ARATH; LOB domain-containing protein 15
TrEMBLU5FGN91e-123U5FGN9_POPTR; Uncharacterized protein
STRINGPOPTR_0019s14790.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-73LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]