PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0200s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 299aa    MW: 33900.5 Da    PI: 7.4282
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0200s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-1892145356
                             --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             k+++++ eq+++Le+ Fe  +++  e++ +LA++lgL+ rq+ +WFqNrRa++k
  SapurV1A.0200s0040.1.p  92 KKRRLSVEQVKTLEKNFELGNKLEPERKMQLARSLGLQPRQIAIWFQNRRARWK 145
                             456899***********************************************9 PP

2HD-ZIP_I/II130.56.4e-4291181191
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             ekkrrls eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlE dy+ Lkr++da+k+en++L++++++L
  SapurV1A.0200s0040.1.p  91 EKKRRLSVEQVKTLEKNFELGNKLEPERKMQLARSLGLQPRQIAIWFQNRRARWKTKQLEIDYDLLKRQFDAVKAENNALQTQNQKL 177
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reel 91 
                             ++e+
  SapurV1A.0200s0040.1.p 178 HAEI 181
                             *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1970148IPR009057Homeodomain-like
SuperFamilySSF466898.13E-2074149IPR009057Homeodomain-like
PROSITE profilePS5007117.5487147IPR001356Homeobox domain
SMARTSM003898.7E-1890151IPR001356Homeobox domain
CDDcd000865.87E-1692148No hitNo description
PfamPF000461.6E-1592145IPR001356Homeobox domain
PRINTSPR000316.9E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.9E-6127143IPR000047Helix-turn-helix motif
PfamPF021831.9E-14147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MIKMIINLPL LSIQFCPLAH PETFMVPSQS DLSLSLRANL TRCIQSVFFM AGVASFLGKR  60
PSMSFSGIDV CHEDQGNGDD ELSDDGSQAG EKKRRLSVEQ VKTLEKNFEL GNKLEPERKM  120
QLARSLGLQP RQIAIWFQNR RARWKTKQLE IDYDLLKRQF DAVKAENNAL QTQNQKLHAE  180
ILALKNKEPT ESINLNKETE GSCSFRSENS SDVKLDIART PAIDSPLPNH HPLSRTFFPS  240
SSTRPAGAAQ LFQTSSSRPD FRCQKMDQMV KEESLTNMFC SIEDQSGFWP WLEQQQFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0200s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462327.11e-161homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-101ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLB9HJT51e-160B9HJT5_POPTR; Uncharacterized protein
STRINGPOPTR_0008s14770.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-104HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]