PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0194s0140.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 375aa    MW: 41024.3 Da    PI: 6.7853
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0194s0140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.4e-18202256256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  SapurV1A.0194s0140.1.p 202 RKKLRLSKEQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 256
                             788899***********************************************98 PP

2HD-ZIP_I/II126.79.8e-41202292192
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rlskeq+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eL
  SapurV1A.0194s0140.1.p 202 RKKLRLSKEQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLNKELQEL 288
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reelk 92 
                             r +lk
  SapurV1A.0194s0140.1.p 289 R-ALK 292
                             9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.281198258IPR001356Homeobox domain
SuperFamilySSF466894.23E-18200267IPR009057Homeodomain-like
SMARTSM003893.6E-16200262IPR001356Homeobox domain
PfamPF000463.6E-15202256IPR001356Homeobox domain
CDDcd000865.85E-16202259No hitNo description
Gene3DG3DSA:1.10.10.602.0E-17202256IPR009057Homeodomain-like
PROSITE patternPS000270233256IPR017970Homeobox, conserved site
PfamPF021831.9E-10258292IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.6E-25258301IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MQNKREMELG LSLGDAAAAT SKPLGFMEKS TQLSSKLTFG SCMGLSIHTL QEDEDHKLID  60
DHNSSDNTNT RTAAIQASKT ADTSTDPPVQ LDLLPNTPVP RNQNTSLTLP SDNGINFESG  120
SSGNMSRGFD VNRFSAAMVH EDQADQDGAT LSSSPPNSAT SSFQMDFCIY SSKGGSGSNT  180
EAEQAERASS RASDEDENGS ARKKLRLSKE QSAFLEESFK EHNTLTPKQK LALAKELNLR  240
PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR LNKELQELRA LKTSNPFYMQ  300
LPATTLTMCP SCERVATAAT SAAATNATTT TATANNQNHT TDPTSKTTGL SLSSSRPRFY  360
PFSHTQTHPH QPKA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250258RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0194s0140.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041997.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466653e-94HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HPS00.0B9HPS0_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-76homeobox from Arabidopsis thaliana