PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0185s0330.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family B3
Protein Properties Length: 398aa    MW: 44939.2 Da    PI: 8.7928
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0185s0330.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.88.1e-1321110196
                             EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                             f k ++ s    +++  +pkkf++++g +   s   tl+ + g  + v+l  +k  g+ ++ kGW eFv+   +++g f+vF ++g+
  SapurV1A.0185s0330.1.p  21 FYKLMVASILQDKKLQKIPKKFVNKYGDE--LSSIATLTVPCGGIFLVEL--QKDNGKLWFHKGWHEFVECYSIRVGYFLVFLYEGK 103
                             55777777777888889*********865..7779***************..999999***************************99 PP

                             SEE..EEEE CS
                      B3  88 sefelvvkv 96 
                             s+f  +v++
  SapurV1A.0185s0330.1.p 104 SNF--NVHM 110
                             999..6665 PP

2B361.31.6e-19291384198
                             EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                             f+ +l ps+v +  +l +p +fa+++ + + ++   +tl+  +g++W v++  + k+g+  l++GW eFv +n+L+egD+++F+l++
  SapurV1A.0185s0330.1.p 291 FQVILRPSYVYRGFLLHIPSSFARTFlNRV-TG--FVTLQVCDGKQWPVRC--SFKDGKAKLGQGWTEFVWENNLEEGDVCIFELIH 372
                             88999******************9995444.34..49999999********..66666677*************************9 PP

                             SSEE..EEEEE- CS
                      B3  87 rsefelvvkvfr 98 
                              ++  ++v +fr
  SapurV1A.0185s0330.1.p 373 AKDIVMKVAIFR 384
                             999999999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-1917112IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.55E-1917112IPR015300DNA-binding pseudobarrel domain
CDDcd100179.18E-1620112No hitNo description
PfamPF023621.2E-921111IPR003340B3 DNA binding domain
PROSITE profilePS5086311.36421114IPR003340B3 DNA binding domain
SMARTSM010191.9E-821114IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-26283384IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-25284384IPR015300DNA-binding pseudobarrel domain
CDDcd100172.09E-24289384No hitNo description
PfamPF023624.5E-18291384IPR003340B3 DNA binding domain
PROSITE profilePS5086314.917291386IPR003340B3 DNA binding domain
SMARTSM010195.7E-18291386IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSQSAGKPDG SDSPARKSCM FYKLMVASIL QDKKLQKIPK KFVNKYGDEL SSIATLTVPC  60
GGIFLVELQK DNGKLWFHKG WHEFVECYSI RVGYFLVFLY EGKSNFNVHM YDLTVSEIKN  120
PCNSISQLQE SSHDNPCLLP HEKDDGLKKI LGFRPPSPNL LSSTTSKNFN EYVHCNWPQS  180
TYTASLEKPH VRTDAYNLRE NCQSSRDIGT QFNGGELTST EDGVGSIISG ITAKTSGSKR  240
MSENSIQNVK QKLSVKNTSE THTRRQRAVT PEEKERTIRA AHMFRPANPF FQVILRPSYV  300
YRGFLLHIPS SFARTFLNRV TGFVTLQVCD GKQWPVRCSF KDGKAKLGQG WTEFVWENNL  360
EEGDVCIFEL IHAKDIVMKV AIFRVLEDAV PPDQLSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-4826038718144B3 domain-containing transcription factor VRN1
4i1k_B9e-4826038718144B3 domain-containing transcription factor VRN1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0185s0330.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454808.10.0B3 domain-containing transcription factor VRN1 isoform X3
TrEMBLA0A2K2AUS20.0A0A2K2AUS2_POPTR; Uncharacterized protein
STRINGPOPTR_0004s15410.11e-176(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-80B3 family protein