PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0176s0500.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 279aa    MW: 32475.3 Da    PI: 8.8877
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0176s0500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.13.7e-3161111151
                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                             krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
  SapurV1A.0176s0500.3.p  61 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYST 111
                             79***********************************************96 PP

2K-box873.7e-29129220394
                   K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                             +++++s +   + +++ e++ Lk+++e Lqr++Rh+lGedL+s slkeLq+Leqq++++lk+iR++Kn+l++++i+elq k ke ++
  SapurV1A.0176s0500.3.p 129 ERQSVSPDLDSQGNWTLEYNMLKAKVELLQRNHRHYLGEDLDSVSLKELQNLEQQIDTALKHIRARKNHLMYQSISELQIKIKEKEK 215
                             55666655666799******************************************************************9999888 PP

                   K-box  90 enkaL 94 
                             +  +L
  SapurV1A.0176s0500.3.p 216 ALAQL 220
                             77776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.14253113IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-4053112IPR002100Transcription factor, MADS-box
CDDcd002657.58E-4254131No hitNo description
SuperFamilySSF554553.14E-3354143IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-315575IPR002100Transcription factor, MADS-box
PROSITE patternPS00350055109IPR002100Transcription factor, MADS-box
PfamPF003199.4E-2662109IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-317590IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-3190111IPR002100Transcription factor, MADS-box
PfamPF014862.8E-24139220IPR002487Transcription factor, K-box
PROSITE profilePS5129714.877140228IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MISKRNFTFI ILFLFLSISH FLGVQDCCFL RFFFGSGSWV ILREKRRGQE REMGRGRVQL  60
KRIENKINRQ VTFSKRRAGL LKKAHEISVL CDAEVALIVF SHKGKLFEYS TNACMEKILE  120
RYERCSYAER QSVSPDLDSQ GNWTLEYNML KAKVELLQRN HRHYLGEDLD SVSLKELQNL  180
EQQIDTALKH IRARKNHLMY QSISELQIKI KEKEKALAQL ALRDQQNDGP NPSSFFSPQP  240
PLPCLNIRYQ EEDTEARRNE LDLTLEPIYS CHPGCFGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A6e-2053137184MEF2 CHIMERA
6byy_B6e-2053137184MEF2 CHIMERA
6byy_C6e-2053137184MEF2 CHIMERA
6byy_D6e-2053137184MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0176s0500.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6159640.0AY615964.1 Populus balsamifera subsp. trichocarpa APETALA1-like MADS-box PTAP1-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462609.11e-136truncated transcription factor CAULIFLOWER A isoform X2
SwissprotQ6E6S71e-117AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A2K1ZEP91e-135A0A2K1ZEP9_POPTR; Uncharacterized protein
STRINGcassava4.1_029935m1e-126(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-95MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]