PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0176s0470.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 512aa    MW: 56033.6 Da    PI: 7.3796
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0176s0470.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.8e-41166241277
                             -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                     SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                             Cqv gC++dl++ k+yh+rh+vCevhsk+++v+v+g+eqrfCqqCsrfh l +fD++krsCr+rLa+hnerrrk+q
  SapurV1A.0176s0470.1.p 166 CQVYGCNKDLTSSKDYHKRHRVCEVHSKTAQVIVNGIEQRFCQQCSRFHLLVDFDDGKRSCRKRLAGHNERRRKPQ 241
                             **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-31161227IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.06163240IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.26E-39164245IPR004333Transcription factor, SBP-box
PfamPF031103.0E-31166239IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MDFWSYAAEG KGLLFSDEID LSVDSFARSR KALIGWDTES VESTEFIDFG FSEIPRKPFH  60
GSKTGVGMFG GTDVGDDPSK LLASSPNCMI ASNSSMESGS NHSNSLVESN SQDSSLIDLK  120
LGTLADFKDA QNSKFSKERL LLSSVSPTAQ AKRARTTCSR PQTTFCQVYG CNKDLTSSKD  180
YHKRHRVCEV HSKTAQVIVN GIEQRFCQQC SRFHLLVDFD DGKRSCRKRL AGHNERRRKP  240
QLGTLSVKPH KLLLPYQGSK FLGTSFPKKT SLLFPNMLPG STFYPENYEE ENWCRRIKLE  300
ENSIYSSSSA IPLGNGQLLP KSFLHLHGNG LQKTCGISPP AIDDGNFSNM GTFHELAGAL  360
PSSCALSLLS AESQDLSHSA GNISARPLVS QVSRARHSLD IVNKSSGVGS LDKYLPNGLY  420
SSGTNFTEVN NMGPFVVSGS GHASDFQVET DGFLHQSDIL NAKYCVSPET GSTVDLLQLS  480
SHLQRVEQQR NSIQVKHENE DFCSFGSTYG V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281652391084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0176s0470.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018928.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011018937.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011018949.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLB9HIG50.0B9HIG5_POPTR; Uncharacterized protein
STRINGPOPTR_0008s09750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-53SBP family protein