PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0173s0340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23043.6 Da    PI: 9.8365
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0173s0340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.21.1e-28958150
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            krien+s r vtfskRrng++KKA ELSvLCd+++a++ifss+gklye+s
  SapurV1A.0173s0340.1.p  9 KRIENNSSRLVTFSKRRNGLFKKARELSVLCDVQIALLIFSSRGKLYEFS 58
                            79***********************************************8 PP

2K-box45.24.1e-1678167998
                   K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                             +++++ae  + ++a  k+  e L    R+l G    + +l +L +Le+qL+ +l+++R++K +l+le+++ l  +ek+l een+ ++
  SapurV1A.0173s0340.1.p  78 ATANHAEVNCGKHAYFKSHAELLLMIERKLEGPHAMEQTLSDLVELEKQLDAALTHVRARKIQLMLESVKSLHDQEKMLTEENQLIE 164
                             566777788889999999999999999*********************************************************999 PP

                   K-box  96 kkl 98 
                             k++
  SapurV1A.0173s0340.1.p 165 KQI 167
                             987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.515161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-29283IPR002100Transcription factor, MADS-box
CDDcd002651.37E-35271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.71683173IPR002487Transcription factor, K-box
PfamPF014863.3E-1289167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRKKVELKR IENNSSRLVT FSKRRNGLFK KARELSVLCD VQIALLIFSS RGKLYEFSGV  60
DRTASILKRY ESRFEKVATA NHAEVNCGKH AYFKSHAELL LMIERKLEGP HAMEQTLSDL  120
VELEKQLDAA LTHVRARKIQ LMLESVKSLH DQEKMLTEEN QLIEKQIVAL MKDGKDSDHT  180
PGKDSDHTPG HPPQQITLSL LK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-18171171MEF2C
5f28_B4e-18171171MEF2C
5f28_C4e-18171171MEF2C
5f28_D4e-18171171MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0173s0340.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024452986.11e-103MADS-box protein FLOWERING LOCUS C
RefseqXP_024452987.11e-103MADS-box protein FLOWERING LOCUS C
RefseqXP_024452988.11e-103MADS-box protein FLOWERING LOCUS C
TrEMBLA0A3N7EUB61e-101A0A3N7EUB6_POPTR; Uncharacterized protein
STRINGEOX997861e-55(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14472412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.11e-45MIKC_MADS family protein