PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0162s0390.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 755aa    MW: 82677.6 Da    PI: 6.3522
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0162s0390.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-162468147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                            r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  SapurV1A.0162s0390.1.p 24 RERWTEEEHSRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                            78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.521973IPR017930Myb domain
TIGRFAMsTIGR015571.0E-162271IPR006447Myb domain, plants
SMARTSM007171.2E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-82464IPR009057Homeodomain-like
PfamPF002496.0E-132467IPR001005SANT/Myb domain
CDDcd001672.96E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MEIFSSGEDL VIKTRKPYTI TKQRERWTEE EHSRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVVKG VSIGQALDIE IPPPRPKKKP SNPYPRKIGV GPPASQVGAK  120
DGKLLTSASF PRCKQVLGLE KEPLPEKING DERPTNAKDN QDDNSSEVFP LLQEPHYSSV  180
SSVNKNPVPT LEILKKTSPF REFVSSAKEG NHDASNQSFV TVELGANQKL DNSDVKQTVQ  240
DSNTSEFSKS ENFNSFSENL FQQKKSDDFI GALRTDGMQT MQNYPRHVPV HVLDGSLGTC  300
MQTPPSDFSF QDSMFHPIGE IPACPNLYPH SAASKTTDHP NLSPRPSTHQ SFPSFPPFTP  360
THHNQEDYKS FLHISSTFSS LIVSTLLQNP AAHAAASFSA TFWPYGNVES SVDSPACAQG  420
GFQSRQLNSA PSMAAIAAAT VAAATAWWAT NGLLPMCAPL HTDFPCPPAT AIQSVDTGEV  480
SATKTERKET TENPVQDPEH TEAVQAQNAS KSPKITSSDC EESGGSRLNT VPEVVDLELT  540
TTPHEVQDSS KTKSRKQIDR SSCGSNTPSS SEIETDALKK VEKGTEEPKE DDANHPASES  600
SSHRCRSSSS TSDSWKAVSE EGRLAFQALF TREVLPQSFS PPYMHQKEDT GEKKDADEKD  660
GDASLIDLNS KTWEHCSGHH QEGEKNALPR CENYGEEGLL TIGLGHGKLK ARRTGFKPYK  720
RCSLEAKESR MGTGGGQGEE KGPKRLRLEG EASV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0162s0390.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1480670.0EF148067.1 Populus trichocarpa clone WS0127_E23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024441064.10.0protein LHY isoform X1
RefseqXP_024441065.10.0protein LHY isoform X1
RefseqXP_024441066.10.0protein LHY isoform X1
TrEMBLA9PI510.0A9PI51_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-118MYB_related family protein