PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0161s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 270aa    MW: 30497.1 Da    PI: 4.8812
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0161s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.62.5e-3910107198
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             aCa+Ck++rrkC+++C+lapyfp +qpk f+n+hklFG++++lk+l++l+ +++e+am+s++y+A++r r Pv+G+ g+i kl+ q+
  SapurV1A.0161s0030.1.p  10 ACASCKYQRRKCSSECPLAPYFPPDQPKMFQNAHKLFGVRKILKILENLESHQQEEAMRSIIYQANIRDRFPVHGCWGIICKLHFQI 96 
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallk 98 
                             +q+++el+++ 
  SapurV1A.0161s0030.1.p  97 RQVEEELHAVL 107
                             *******9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3779110IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-3710106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSSECPLAPY FPPDQPKMFQ NAHKLFGVRK ILKILENLES  60
HQQEEAMRSI IYQANIRDRF PVHGCWGIIC KLHFQIRQVE EELHAVLAHL EMYRQQQQQI  120
AALTEDVTSQ LELGMAPPQP CLAQQYSYSI IGSNIGYSSN YLDSNDNVGN SLWGQHPYAT  180
NYDTSSMPII QSQLVASQPL ASQQEEVQNY DEMHPFFDTI DDRQSYIETK EPYESSSEES  240
LKDTAPSMEH AAENELKSAA ACFTLTSIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-2961237122LOB family transfactor Ramosa2.1
5ly0_B9e-2961237122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0161s0030.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321540.11e-178LOB domain-containing protein 27
SwissprotQ9STS69e-58LBD27_ARATH; LOB domain-containing protein 27
TrEMBLB9IEH61e-176B9IEH6_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07780.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-45LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]