PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0157s0170.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27577.3 Da    PI: 10.0449
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0157s0170.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.99.9e-322474151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  SapurV1A.0157s0170.3.p 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
                            79***********************************************95 PP

2K-box114.21.3e-37921884100
                   K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                             s++ s++ea+a+ +qqe+akL+++i nLq+++R++lGe+L++Ls+keL++Le +Lek++++iRskKnell+++ie++qk+e +l+++
  SapurV1A.0157s0170.3.p  92 SNNGSVSEANAQFYQQEAAKLRSQIGNLQNSNRNMLGESLSTLSVKELKSLEIKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNN 178
                             444459********************************************************************************* PP

                   K-box  91 nkaLrkklee 100
                             n+ Lr+k++e
  SapurV1A.0157s0170.3.p 179 NQLLRAKIAE 188
                             *******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.4591676IPR002100Transcription factor, MADS-box
CDDcd002651.62E-441793No hitNo description
SuperFamilySSF554553.66E-331789IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-331838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003198.9E-272572IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-333853IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-335374IPR002100Transcription factor, MADS-box
PfamPF014866.5E-28100186IPR002487Transcription factor, K-box
PROSITE profilePS5129715.153102192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MAYQNESQLS SPLRKLGRGK VEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYSNNSVKST IERYKKACAD SSNNGSVSEA NAQFYQQEAA KLRSQIGNLQ  120
NSNRNMLGES LSTLSVKELK SLEIKLEKGI SRIRSKKNEL LFAEIEYMQK REIDLHNNNQ  180
LLRAKIAENE RKRQNMNLMP GGASFEIMQP QPFDSRNYSQ VHGLPPANHY SHEDQMSLQL  240
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q4e-201684169Myocyte-specific enhancer factor 2B
1tqe_R4e-201684169Myocyte-specific enhancer factor 2B
1tqe_S4e-201684169Myocyte-specific enhancer factor 2B
5f28_A5e-2016100187MEF2C
5f28_B5e-2016100187MEF2C
5f28_C5e-2016100187MEF2C
5f28_D5e-2016100187MEF2C
6c9l_A4e-201684169Myocyte-specific enhancer factor 2B
6c9l_B4e-201684169Myocyte-specific enhancer factor 2B
6c9l_C4e-201684169Myocyte-specific enhancer factor 2B
6c9l_D4e-201684169Myocyte-specific enhancer factor 2B
6c9l_E4e-201684169Myocyte-specific enhancer factor 2B
6c9l_F4e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0157s0170.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7143860.0JQ714386.1 Populus simonii x Populus nigra isolate A flowering locus C (FLC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002033.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
RefseqXP_011002034.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
RefseqXP_011002035.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408721e-136AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLO651121e-162O65112_POPTR; AGAMOUS homolog
STRINGEOY278721e-150(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-117MIKC_MADS family protein