PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0155s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1115aa    MW: 121426 Da    PI: 8.5883
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0155s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.48.5e-0765121157
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                             +r+R  ++++ ++ ++e+F  +  +s++e +e++++ g t +qV+ +F  +R++ +k
  SapurV1A.0155s0080.1.p  65 KRPRDLINPKAVKYMQEVFSIKDAISKKESREISAQFGATVTQVRDFFASQRMRVRK 121
                             799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89662122IPR001356Homeobox domain
SMARTSM003891.3E-464126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-665127IPR009057Homeodomain-like
CDDcd000863.30E-565121No hitNo description
SuperFamilySSF466891.33E-665125IPR009057Homeodomain-like
SuperFamilySSF476764.84E-6320412IPR017923Transcription factor IIS, N-terminal
Gene3DG3DSA:1.20.930.101.5E-4320412IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1115 aa     Download sequence    Send to blast
MEDLTVTEIG SSVESFQKFL DSQRELFHNQ IDHLQRIVVT QCKLTGVNPL SQEMAAGALS  60
IQIGKRPRDL INPKAVKYMQ EVFSIKDAIS KKESREISAQ FGATVTQVRD FFASQRMRVR  120
KLVRLSREKA IRVNAHKGPQ DGVPTTTDAS MPTDLAPLNS VDQNPVSMNT VSPNPAPLNA  180
AIPNPFYLNS VAPNPVPFSF VSCNSAPLIA ASPTPSPLNS ARPDPVPLIS FSPNPAPLNP  240
ASLNPVPLDS VALDPVPLNA VGPSRVDEAP SCSTQDDVLP GLDELDKHFA EKIFDLLRKE  300
ETFSGQVKLM EWILQIQTPA VLNWFLVKGG VMILATWLSQ AAAEEQTSVL LVTLKVFCHL  360
PLHKAPPEHM SAVLHSVNGL RFYRTSDISN RARVLLSKWS KMFAKSQAIK KPNCVKSSTD  420
AQDMILKQSI DEIMANESWQ SDIGNPDGVL ALSFESSENI RKIESSQTLK LLPASTDDMS  480
RKQILGASSS YTRERRKVQL VEQPGQKTAG RSPQATKASP VNQGRPMSAD DIQKAKMRAL  540
FMQNKHGKLG SSSNGSTGLK NGGLNKPSSM TTSLCPVSKI HIRPKIEEYI KPVTPPTQVS  600
SKAEGSLDLK KEINSKGPMG GVCSKVQIPW QTPPEIKLDT LWRVGTGENS KEVDVQKNRN  660
RREIETIYQT VQKIPSNPKE PWDLEMDYDD TLTPEIPIEQ PPDADVAETQ VSHTEHVNTV  720
VASAPSLPQV GGGSATEPDL ELLAVLLKNP ELVFALTSGQ AGNLSSEETV KLLDMIKTGG  780
GLAGSLNGLG GKVEEKVEVS LPSPTPSSNN PGTSGWRSEV AKNPFSQQAS MGNRVVYSDP  840
GVPTSVPLAE QHTSLVQHQN QATSIRILQQ QASFPLQSQH VSAVMNPFSL PQTSSIGRDN  900
RQPSIALPAN QSYPSNSSLL QTLSSEMVST MKILPAPSLN LSAAMNNIKS TPSVSFTSNP  960
ERQPFPFPPS SALPTPTQLQ SQPAQINDPL IVYSSRPHAG DAGPVADSWR ARQGLASNSP  1020
SQANQINYVS SSGRPVQPSL QSGPPWERNE YVGDEGYESW SPESRRNESQ EHMPGRNYSG  1080
TRSRTNSGWD YNRSRQRNSS GHGDRNWNGN RRWH*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0155s0080.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009535.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387961e-176LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1R9330.0A0A2K1R933_POPTR; Uncharacterized protein
STRINGPOPTR_0014s12730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-166HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]