PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0116s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 453aa    MW: 50685.9 Da    PI: 5.4028
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0116s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.52.1e-92504492373
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl.. 83 
                             ++lL++c++a++s+d++l q++L+ l+++a pdgd++qRla  f++AL ar ar  ++++k l++ e+++ n    ++++++ +l  
  SapurV1A.0116s0200.1.p  50 EQLLVHCVNAIESNDATLSQQILWVLNNIAPPDGDSNQRLACAFLRALIARAAR--TGTCKLLASMESAHFNlaiDTHKFSIIELas 134
                             79****************************************************..7888888777777766544333333333366 PP

                    GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLak 167
                             f++++P+++f++ +aN aIleaveg   vHi+D+++++++Q p+L++a+a+R e pp +++T+ g+ e +      ++ee+g++L +
  SapurV1A.0116s0200.1.p 135 FVDLTPWHRFGYTAANAAILEAVEGYLVVHIVDLSLTHCMQIPTLIDAIANRFEVPPLIKLTVAGAIEDVpplLDLSYEELGSKLVN 221
                             ******************************************************************88889888999********** PP

                    GRAS 168 fAeelgvpfefnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll................desvsleserdevLkl 230
                             fA++ +v +ef+v+        ++ +e+l++++L   + gEal++n++++lh ++                 es s++s r+ +Lk 
  SapurV1A.0116s0200.1.p 222 FARSRNVIMEFRVIpssyadgFSSFIEQLRVQHLVYAEsGEALVINCHMMLHCIPeetlsgihstnsntysYESPSISSFRSMFLKS 308
                             **************8885554445555556666655559********************************9*************** PP

                    GRAS 231 vkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                             ++sl P++vv+v+++ad +s++++ r+ +a++y +  +d++++ lpr s++r+++E+  ++++i+nv+a+eg +r+er e + +W +
  SapurV1A.0116s0200.1.p 309 LRSLDPTLVVLVDEDADFTSNNLVSRLKSAFNYLWIPYDTVDTFLPRGSRQRQWYEAD-ISWKIENVIAHEGLQRVERLEPKCQWIQ 394
                             **********************************************************.**************************** PP

                    GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                             r+++a F+ +++ e+a +++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  SapurV1A.0116s0200.1.p 395 RMRNANFRGISFAEDAISEVKTMLDEHA-AGWGLKKEDDDIVLTWKGHNVVFASAW 449
                             ****************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.80223431IPR005202Transcription factor GRAS
PfamPF035147.1E-9050449IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MMQFTETPLP PLHQITTPIS NPTMNKNRPW PAGFPTSKSL GSFGDANCME QLLVHCVNAI  60
ESNDATLSQQ ILWVLNNIAP PDGDSNQRLA CAFLRALIAR AARTGTCKLL ASMESAHFNL  120
AIDTHKFSII ELASFVDLTP WHRFGYTAAN AAILEAVEGY LVVHIVDLSL THCMQIPTLI  180
DAIANRFEVP PLIKLTVAGA IEDVPPLLDL SYEELGSKLV NFARSRNVIM EFRVIPSSYA  240
DGFSSFIEQL RVQHLVYAES GEALVINCHM MLHCIPEETL SGIHSTNSNT YSYESPSISS  300
FRSMFLKSLR SLDPTLVVLV DEDADFTSNN LVSRLKSAFN YLWIPYDTVD TFLPRGSRQR  360
QWYEADISWK IENVIAHEGL QRVERLEPKC QWIQRMRNAN FRGISFAEDA ISEVKTMLDE  420
HAAGWGLKKE DDDIVLTWKG HNVVFASAWL PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-473145166474Protein SHORT-ROOT
5b3h_B4e-483145112420Protein SHORT-ROOT
5b3h_E4e-483145112420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0116s0200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013594.10.0PREDICTED: scarecrow-like protein 32 isoform X1
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2K1ZPQ70.0A0A2K1ZPQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s10030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-177GRAS family protein