PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0103s0310.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 276aa    MW: 27955.1 Da    PI: 10.3877
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0103s0310.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.32.6e-3843130390
                     TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgk 89 
                             +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ + s+ +++ns+s +
  SapurV1A.0103s0310.1.p  43 AKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTVSVSVRAGGNSNSIS 129
                             79******************************************************************8883333333333322222 PP

                     TCP  90 a 90 
                             +
  SapurV1A.0103s0310.1.p 130 S 130
                             2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-3348137IPR005333Transcription factor, TCP
PROSITE profilePS5136928.20948102IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MSDNSGAVNN GSLIDPQRNQ PPGGAGGGGG GGGGGGTNGA LVAKKPPSKD RHSKVDGRGR  60
RIRMPIICAA RVFQLTRELG HKSDGQTIEW LLRQAEPSII AATGTGTTPA SFSTVSVSVR  120
AGGNSNSISS LSSNNIHSAG SLEHKPLLGP APFILGKRMR PEEDGNGGGK NDDGVSVGPT  180
IGSLMGPTAT AGPGGFWALP ARTDFWGFAA AATPEMDVQP TAVQQSSLIM HHQHAAAMGE  240
ASAARVGNYL PGHLNLLASL SGGTASSGRR EDDRR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0103s0310.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2394355e-32AC239435.2 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-305j13 map 1, complete sequence.
GenBankGQ4963335e-32GQ496333.1 Solanum lycopersicum TCP transcription factor 15 (TCP15) mRNA, complete cds.
GenBankHG9754405e-32HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755135e-32HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002260.11e-142PREDICTED: transcription factor TCP21-like
SwissprotQ9FMX21e-87TCP7_ARATH; Transcription factor TCP7
TrEMBLB9H5Q11e-127B9H5Q1_POPTR; TCP family protein
STRINGPOPTR_0005s09250.21e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.15e-62TCP family protein