PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0100s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARR-B
Protein Properties Length: 677aa    MW: 74698.6 Da    PI: 6.1356
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0100s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27209262155
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             kpr++W+ +LH++Fv+av+q+ G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  SapurV1A.0100s0230.1.p 209 KPRVVWSVDLHQKFVSAVNQM-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 262
                             79*******************.********************************8 PP

2Response_reg83.18.4e-28241321109
                             EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
            Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                             +l vdD+p+ +++l+++l+k +y ev+++ ++  ale+l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e 
  SapurV1A.0100s0230.1.p  24 ILAVDDDPICLKVLESLLRKCQY-EVTTTNQAITALEMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEF 108
                             799********************.***************999889*******************87754.558************** PP

                             HHHHHHTTESEEEESS--HHHHHH CS
            Response_reg  86 alealkaGakdflsKpfdpeelvk 109
                             + + +  Ga d+l Kp+ +eel +
  SapurV1A.0100s0230.1.p 109 VYKGVTHGAVDYLLKPVRMEELKN 132
                             *********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.0E-1631676IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23008.5E-4321157No hitNo description
SuperFamilySSF521723.98E-3721146IPR011006CheY-like superfamily
SMARTSM004486.4E-3522134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.19823138IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.4E-2524132IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.02E-2925138No hitNo description
Gene3DG3DSA:1.10.10.603.5E-29206267IPR009057Homeodomain-like
PROSITE profilePS5129411.787206265IPR017930Myb domain
SuperFamilySSF466891.45E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-24209262IPR006447Myb domain, plants
PfamPF002491.5E-6211260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MMTVYYQRGG NLVSEKKFPV GMRILAVDDD PICLKVLESL LRKCQYEVTT TNQAITALEM  60
LRENRNKYDL VISDVNMPDM DGFKLLELVG LEMDLPVIML SSHGDKEFVY KGVTHGAVDY  120
LLKPVRMEEL KNIWQHVIRR KKWYPKDQNR SPNQDKVDDG AGEGEHGVTS TGSADQNGKL  180
NRKRKDQDEE DEEEGEDGDD NEVSGNQKKP RVVWSVDLHQ KFVSAVNQMG LDKAVPKKIL  240
DLMNVDGLTR ENVASHLQKF RLYLKRISCG GNQQGNMVSA YGANDASYLR MNSADGFGDF  300
RSMHGPGFQL STTSLSSYPP GTLLGRLNSP GGLTLRGIAS SGLLQPGLLP TNQGKNLFQG  360
ISLEPKQLQM KSINHFGEFN HKRDTAGFTL ASCFPDVKVT IGSSSNTISS VTSSLPILQA  420
NPQQNHSKGS LVTQSSLRMP SLNQESFDVG VHGSSNFLDH SRCDDSWQSA VQLSAFPSFR  480
HDPLPSSTLR DNLSSTTSHI VNSPIDFSST VSLRAPLEDS RVDMQGQTDF IGNIFQNTTN  540
YISKNRWEEN SQNYNPGLNG SFGAMNSLVS GNASSGALYQ SMDQRKRFGA SMIGQSNSGT  600
LSMFQHPDVE NFALDPKMRS NEDVTLEQTK SQNGFVQNNY ESLDDIMNAM MKQGQNDASL  660
MGGEFRFGSF SPGSCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25207268364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0100s0230.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG5181560.0HG518156.1 Populus x canadensis RR18 gene for response regulator, cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308388.30.0two-component response regulator ARR12 isoform X2
SwissprotQ6K8X61e-125ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2K2A4F10.0A0A2K2A4F1_POPTR; Two-component response regulator
STRINGPOPTR_0006s20220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-123response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]