PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0091s0280.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GATA
Protein Properties Length: 328aa    MW: 36100.5 Da    PI: 7.3831
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0091s0280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18246279134
                    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                             Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  SapurV1A.0091s0280.1.p 246 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 279
                             *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.0E-805324IPR016679Transcription factor, GATA, plant
SuperFamilySSF577163.28E-14239302No hitNo description
SMARTSM004019.3E-14240294IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.345240276IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-14244277IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.98E-14245302No hitNo description
PfamPF003204.1E-16246279IPR000679Zinc finger, GATA-type
PROSITE patternPS003440246271IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEFCMEIKAL KSSLLRELAT KSTQQAFFED FPALNTPAVV SSDQDFSVDC FLDFSNGEFK  60
DGYAQEEEEE EKDSLSVSSQ DPVNDDINYS SISDSFLASE LAVPTDEIAV LEWVSHFVDD  120
SLSDVSLLVP ACKGKLENHA KNRVEPEPRP SLSKTTVFPP SRVPSKARTK RSRPTGRTWS  180
GSSNQTETPS SSASSTSSMP CLVSANSVQT IDSLSWLSEP PMKKPKKRPA AQTSGLMASP  240
QFQRRCSHCQ VQKTPQWRTG PLGAKTLCNA CGVRYKSGRL FPEYRPACSP TFSSEVHSNS  300
HRKVLEMRKK KDTGGPESRL SHMVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037193.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLB9H0W81e-178B9H0W8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16860.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.24e-49GATA transcription factor 5