PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0086s0410.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 169aa    MW: 19596.2 Da    PI: 9.7926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0086s0410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.93.4e-3851041100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk +rrkC +dC++apyfpae++++f++vhk FG +nv+++l++lp ++r+da+ slvyeA+ar+rdPv G++++i++l+q++
  SapurV1A.0086s0410.1.p   5 SCAACKNHRRKCDDDCFIAPYFPAEKSRDFEAVHKHFGLHNVISILRSLPLQQRSDAVISLVYEANARVRDPVGGCTRIISALRQRI 91 
                             6************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++lka+l+ +k++
  SapurV1A.0086s0410.1.p  92 NTLKAQLNFVKNQ 104
                             ********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.6974105IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-375102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MRRPSCAACK NHRRKCDDDC FIAPYFPAEK SRDFEAVHKH FGLHNVISIL RSLPLQQRSD  60
AVISLVYEAN ARVRDPVGGC TRIISALRQR INTLKAQLNF VKNQNAYYRT MKQQQLRQQN  120
MVHNAGFVDF LRENNFPSSN QDFNLLHENL ENPQQLQNPS SAQNQIAYH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-2869912105LOB family transfactor Ramosa2.1
5ly0_B9e-2869912105LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0086s0410.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024458812.12e-94LOB domain-containing protein 12
SwissprotQ9SHE94e-29LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A3N7F5N54e-93A0A3N7F5N5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s24470.13e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2312934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-31LOB domain-containing protein 4