PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0085s0450.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 149aa    MW: 16288.6 Da    PI: 8.3851
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0085s0450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.57.4e-46141131100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+Ca+dCv+apyfp ++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+
  SapurV1A.0085s0450.1.p  14 PCAACKLLRRRCAEDCVFAPYFPPDEPHKFASVHKVFGASNVNKMLQELPEHQRRDAVSSMVYEANARVRDPVYGCVGAISSLQQQI 100
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             ++l+++la++++e
  SapurV1A.0085s0450.1.p 101 HSLQTQLAAAQAE 113
                             ********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.46513114IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4514111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MIKESGRKQG ALSPCAACKL LRRRCAEDCV FAPYFPPDEP HKFASVHKVF GASNVNKMLQ  60
ELPEHQRRDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI HSLQTQLAAA QAEVVHMRMR  120
QFSSSSNTGG AMDMAVNQAN MGESLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-53101157112LOB family transfactor Ramosa2.1
5ly0_B2e-53101157112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0085s0450.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456989.12e-97LOB domain-containing protein 4
SwissprotQ9SHE95e-68LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2I4KKM64e-96A0A2I4KKM6_POPTR; LBD family protein
STRINGXP_002513395.11e-93(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-64LOB domain-containing protein 4