PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0082s0460.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family G2-like
Protein Properties Length: 435aa    MW: 47714.9 Da    PI: 8.5655
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0082s0460.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32250303255
                 G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                             pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  SapurV1A.0082s0460.1.p 250 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 303
                             9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15247304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28248304IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-24250303IPR006447Myb domain, plants
PfamPF002496.0E-7251302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MPQKRIFDKQ SLNLIPDLSL HISLPNSAPS SICTDDGDFA FDIWRKDDGL KSHSDSSIRA  60
GSQADTELYL AKPANTALEA ESRWRRSFCG RGAGSTAEGH NHGQARQRNL LLQCSSNGQM  120
SRINHGISVL DVTGLKPIKG IPVYNSWNSS GDIDPRFSFN QMPYSSPPCT PYSSSNSSAD  180
HHKPPFQAYR MDSSAPRFNG MSMETMRAPQ YHQYGAPTVG SGTGAEVYGS GMIRSRFMPK  240
SQNKRNMRAP RMRWTSSLHA RFVHAVELLG GHERATPKSV LELMDVKDLT LSHVKSHLQM  300
YRTVKSTDCR PAASSDGSGD EDFMPGKACS NQNGNYLLNP KGGSNVPQHD NGYPNSPTNL  360
WSNSSSKGGW HNSSRDLDGL KVEAPSSQQE SGNNLDGVGF AQSRSITGLI DQELKNPILE  420
FSLGRPDWQN KEHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-17251305357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-17251305357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-17251305357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-17251305357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0082s0460.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437724.10.0transcription repressor KAN1 isoform X1
TrEMBLA0A2K1Y8N80.0A0A2K1Y8N8_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-60G2-like family protein