PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0072s0340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 498aa    MW: 54284.9 Da    PI: 8.0704
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0072s0340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.5e-42166241277
                             -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                     SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                             Cqv +C++dls+ k+yh+rhkvCevh+k+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  SapurV1A.0072s0340.1.p 166 CQVYDCNKDLSSSKDYHKRHKVCEVHTKTPQVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 241
                             **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-32161227IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.052163240IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-39165244IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31166239IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MDFWSYASEG KGLLLSDEID LSADAFTRSR KASIGCDTEA VESSELLDLG FSEIPRKPFH  60
GSKTGAGMFG GSCVGIDSSK PAVVSPSCMI ASNSSMESGS NHSNSLMESN SPDSSLIDLK  120
LGRLADCKDA QNSKFPKERL LLSSVSPPAQ AKRARTASLR PQTSFCQVYD CNKDLSSSKD  180
YHKRHKVCEV HTKTPQVIVN GIEQRFCQQC SRFHLLVEFD DGKRSCRKRL AGHNERRRKP  240
QYGTKFLGSP LPKRTSFPFP NVLPGGAFCP QSYEEDNWRK CVKSEENSIY SSPSAIPMRN  300
GQLLPKSFLH LHGNRIQKTC GISPLDTEDC TISNTATTIH ELAGVSPSSR ALSLLSAESQ  360
DLSHSAGNIM VRPLVSQVGG AFQTLGIANK SLGVGSSEKY VSIGANSFGM NFIEVDDTGP  420
FGVSDSAHAA DLKVATAGFL HQSGFLNDKH RVSSENGSTV DWLQLSSHLQ RVEQQRNSMQ  480
VKHENEDFCR FGVPYRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291652391084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0072s0340.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091030.0AC209103.1 Populus trichocarpa clone POP056-L16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011660.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011011667.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_011011676.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_024467055.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A2K1YUI30.0A0A2K1YUI3_POPTR; Uncharacterized protein
STRINGPOPTR_0010s16400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-44SBP family protein