PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0068s0140.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 743aa    MW: 81920.1 Da    PI: 5.7341
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0068s0140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.9e-2153108156
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             r+k  ++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  SapurV1A.0068s0140.1.p  53 RKKYNRHTANQIQELESFFKECPHPDEKQRSELSRRLGLESKQIKFWFQNRRTQMK 108
                             79999************************************************999 PP

2START179.42.2e-562584742205
                             HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                   START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                             la++a++el+k+a+ e+p W ks     e +n +e++++f++  +     +  ea r+sgvv  ++  lve+l+d++  W e+++  
  SapurV1A.0068s0140.1.p 258 LALAAMDELIKMAQIESPIWIKSLdggkEVLNHEEYTRTFPPCIGmkpsnFVFEATRESGVVLIDSLALVETLMDVN-GWVEMFPsl 343
                             6899**********************9999************999999999**************************.********* PP

                             ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                   START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                               +a+t++vissg      galq + ae+q++sp vp R + f+R ++ql++g+w+++dvSvd +q   +      +++lpSg++i+
  SapurV1A.0068s0140.1.p 344 iaRAATIDVISSGmggtksGALQIIHAEFQVISPFVPvRQVKFLRLCKQLTEGVWAVADVSVDGNQTHVT------CRRLPSGCIIQ 424
                             ****************************************************************999765......99********* PP

                             EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                   START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                             ++ ng +kvtwveh +++++ +h+l+r++++sg+ +ga++w a+lqr+ e
  SapurV1A.0068s0140.1.p 425 DMNNGCCKVTWVEHSEYDESAVHQLYRHILNSGMGFGAQRWIAALQRHYE 474
                             ***********************************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-1939110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-213991IPR009057Homeodomain-like
PROSITE profilePS5007118.25350110IPR001356Homeobox domain
SMARTSM003891.5E-1852114IPR001356Homeobox domain
PfamPF000462.8E-1853108IPR001356Homeobox domain
CDDcd000869.46E-1953110No hitNo description
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.600.00192135IPR009057Homeodomain-like
PROSITE profilePS5084838.472248478IPR002913START domain
SuperFamilySSF559619.77E-33250474No hitNo description
CDDcd088754.12E-113252474No hitNo description
SMARTSM002344.0E-40257475IPR002913START domain
PfamPF018522.8E-48258474IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-4311472IPR023393START-like domain
SuperFamilySSF559618.55E-16503738No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MDSHGDMGLL VEHFDPSLVG RTREDGYESR SGSDNIEGAS GEDQDAGDYQ RPRKKYNRHT  60
ANQIQELESF FKECPHPDEK QRSELSRRLG LESKQIKFWF QNRRTQMKTQ LERHENAILR  120
QENDKLRAEN EMLKHNMSDP ICNSCGGPVV PVPVPYEQQQ LRIENARLKD ELSRVCALAN  180
KFLGRPLTSS ANPVPPFGSN TKLDLAVGRN GYGNLGHTDN TLPMGFDNDG GVMMPLMKPI  240
GDAVGNEVSF DRSMFVDLAL AAMDELIKMA QIESPIWIKS LDGGKEVLNH EEYTRTFPPC  300
IGMKPSNFVF EATRESGVVL IDSLALVETL MDVNGWVEMF PSLIARAATI DVISSGMGGT  360
KSGALQIIHA EFQVISPFVP VRQVKFLRLC KQLTEGVWAV ADVSVDGNQT HVTCRRLPSG  420
CIIQDMNNGC CKVTWVEHSE YDESAVHQLY RHILNSGMGF GAQRWIAALQ RHYECMAILL  480
SPTILGEDQT AINLGGKKSM LKLARRMVDS FCSGVCASTL HNWGNLVVES VSEDVRILTR  540
KIINEPGEPD GIVLSVSTSV WLPVSQQRLF DFLRDEQSRS QWDILSNGGM LQEMVQIPKG  600
QGHWNSVSVL RSTAVDAKAG DNMLILQETW NDVSGSLVVY APVDVQSVSV VMNGGDSTYV  660
ALLPSGFVIL PDNSFSNGEP NSCHGNPAKR DCDGKDGGGS FLTVGFQILA SNLPSAKLTV  720
ESVKTVHNLI SCTMQRIKTA FN*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0068s0140.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322460.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
RefseqXP_024442056.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A3N7G4W50.0A0A3N7G4W5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s13340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]