PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0054s0370.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 174aa    MW: 19841.8 Da    PI: 6.0142
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0054s0370.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601216.6e-38141131100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaC++lrr+C ++C+lapyfp ++++kf  vhk+FGasnv+++++ ++e+++eda+++++yeA  r+rdPvyG++g+i++lq+ +
  SapurV1A.0054s0370.1.p  14 PCAACRMLRRRCDSNCMLAPYFPGDEAEKFFGVHKVFGASNVIRMIQMVEESKKEDAVKAIIYEATSRLRDPVYGSAGTIFHLQKMV 100
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             e lk ++++++++
  SapurV1A.0054s0370.1.p 101 EDLKIQVESMRAQ 113
                             ******9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.107.8E-4728IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089124.42513114IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-3814111IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSSDTLTRTR AHQPCAACRM LRRRCDSNCM LAPYFPGDEA EKFFGVHKVF GASNVIRMIQ  60
MVEESKKEDA VKAIIYEATS RLRDPVYGSA GTIFHLQKMV EDLKIQVESM RAQVVQLQEQ  120
KNQLLGILMN VRHLDSTSSI HERKFDGGDL MLDEDPLMAY DPITFFTEND WTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-3271164113LOB family transfactor Ramosa2.1
5ly0_B7e-3271164113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0054s0370.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321198.11e-117LOB domain-containing protein 1
TrEMBLB9IAT51e-116B9IAT5_POPTR; Uncharacterized protein
STRINGPOPTR_0014s16510.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-44LOB domain-containing protein 1