PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0049s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TCP
Protein Properties Length: 172aa    MW: 18523.9 Da    PI: 5.6952
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0049s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP967.1e-301479570
                     TCP  5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                             ++ +++h kv+gRdRR+Rl+++caar+F++++eLG ++d++tieWLl+ a+p i + tg++  + 
  SapurV1A.0049s0230.1.p 14 PKPRKDRHVKVNGRDRRIRLPINCAARVFQMTRELGNKTDGETIEWLLRVAEPTIVAVTGNGIGPT 79
                            5788*********************************************************55554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.5171771IPR017887Transcription factor TCP subgroup
PfamPF036346.9E-261778IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MNKASTSKTK VADPKPRKDR HVKVNGRDRR IRLPINCAAR VFQMTRELGN KTDGETIEWL  60
LRVAEPTIVA VTGNGIGPTG ANLRYSQAAV VNTAPPVSYS SDLHPLSSAG LSSPLMDPSV  120
EPIQGLISRN CVVSGDEPLS FTSEFDNLET DFDMDFPVSD MFPSVPGNDH A*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0049s0230.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314294.32e-93transcription factor TCP7
SwissprotQ9FMX25e-29TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A2K1Z0T14e-92A0A2K1Z0T1_POPTR; Uncharacterized protein
STRINGXP_002529440.13e-44(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-31TCP family protein