PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0045s0580.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22699.4 Da    PI: 10.4699
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0045s0580.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.91.8e-30959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  SapurV1A.0045s0580.5.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFSS 59
                            79***********************************************96 PP

2K-box74.52.9e-25851711298
                   K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                              + +  +++   L k+ie L+ ++R+l+G +Le++s+ eL+qLe+qLe+sl++iRs+Kn+ll+eqi++l+  ek l een++Lr+k+
  SapurV1A.0045s0580.5.p  85 DNIQPVKEDPFTLAKKIEDLEVSKRKLVGVGLEPCSIDELKQLENQLERSLTRIRSRKNQLLREQIQKLKGEEKILLEENTRLREKV 171
                             5567777788899***********************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.352161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.05E-41271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-32372IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014867.8E-2585171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.08887177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MARGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFSSS  60
SINRTIERYQ KRARDVGISS KMVQDNIQPV KEDPFTLAKK IEDLEVSKRK LVGVGLEPCS  120
IDELKQLENQ LERSLTRIRS RKNQLLREQI QKLKGEEKIL LEENTRLREK VLVLYMLYEL  180
SDPTLSSVAV ILRNASL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-19169169MEF2C
5f28_B4e-19169169MEF2C
5f28_C4e-19169169MEF2C
5f28_D4e-19169169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0045s0580.5.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2247930.0CU224793.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029143.11e-105PREDICTED: agamous-like MADS-box protein AGL19
RefseqXP_011029144.11e-105PREDICTED: agamous-like MADS-box protein AGL19
RefseqXP_011029145.11e-105PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO827436e-76AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLB9GW461e-103B9GW46_POPTR; Uncharacterized protein
STRINGXP_006477351.17e-86(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.14e-72AGAMOUS-like 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Suter L,Rüegg M,Zemp N,Hennig L,Widmer A
    Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis.
    Plant Physiol., 2014. 166(4): p. 1928-42
    [PMID:25339407]