PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0045s0580.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 217aa    MW: 25021 Da    PI: 10.4243
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0045s0580.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.62.1e-30959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  SapurV1A.0045s0580.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFSS 59
                            79***********************************************96 PP

2K-box74.92.2e-25851711298
                   K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                              + +  +++   L k+ie L+ ++R+l+G +Le++s+ eL+qLe+qLe+sl++iRs+Kn+ll+eqi++l+  ek l een++Lr+k+
  SapurV1A.0045s0580.1.p  85 DNIQPVKEDPFTLAKKIEDLEVSKRKLVGVGLEPCSIDELKQLENQLERSLTRIRSRKNQLLREQIQKLKGEEKILLEENTRLREKV 171
                             5567777788899************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.352161IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002653.96E-42271No hitNo description
SuperFamilySSF554553.27E-32372IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-31323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.4E-2585171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.57587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MARGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFSSS  60
SINRTIERYQ KRARDVGISS KMVQDNIQPV KEDPFTLAKK IEDLEVSKRK LVGVGLEPCS  120
IDELKQLENQ LERSLTRIRS RKNQLLREQI QKLKGEEKIL LEENTRLREK VVQCGMQPHE  180
LSSTKKNPQQ LEDRRVMEVE TELFIGPPET RLPQKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_R4e-19169169Myocyte-specific enhancer factor 2B
1tqe_S4e-19169169Myocyte-specific enhancer factor 2B
5f28_A4e-19169169MEF2C
5f28_B4e-19169169MEF2C
5f28_C4e-19169169MEF2C
5f28_D4e-19169169MEF2C
6byy_A4e-19169169MEF2 CHIMERA
6byy_B4e-19169169MEF2 CHIMERA
6byy_C4e-19169169MEF2 CHIMERA
6byy_D4e-19169169MEF2 CHIMERA
6bz1_A4e-19169169MEF2 CHIMERA
6bz1_B4e-19169169MEF2 CHIMERA
6bz1_C4e-19169169MEF2 CHIMERA
6bz1_D4e-19169169MEF2 CHIMERA
6c9l_A4e-19169169Myocyte-specific enhancer factor 2B
6c9l_B4e-19169169Myocyte-specific enhancer factor 2B
6c9l_C4e-19169169Myocyte-specific enhancer factor 2B
6c9l_D4e-19169169Myocyte-specific enhancer factor 2B
6c9l_E4e-19169169Myocyte-specific enhancer factor 2B
6c9l_F4e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0045s0580.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2247930.0CU224793.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024452474.11e-124agamous-like MADS-box protein AGL19 isoform X1
RefseqXP_024452475.11e-124agamous-like MADS-box protein AGL19 isoform X1
SwissprotO827433e-84AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLB9GW461e-123B9GW46_POPTR; Uncharacterized protein
STRINGEOY245839e-97(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-80AGAMOUS-like 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Suter L,Rüegg M,Zemp N,Hennig L,Widmer A
    Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis.
    Plant Physiol., 2014. 166(4): p. 1928-42
    [PMID:25339407]