PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0045s0430.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 239aa    MW: 26604.5 Da    PI: 10.2089
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0045s0430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.46.2e-24171213143
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrksk 43 
                             d+e grCrRtDGKkWRCs+++l+++k+C+rH+hrgr+rsrk  
  SapurV1A.0045s0430.1.p 171 DPEIGRCRRTDGKKWRCSKEALPDQKYCDRHIHRGRQRSRKLE 213
                             79**************************************975 PP

2QLQ34.37.4e-13101136237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             a+T  Qlq+L  Q l+yKy+ a+ PvP +L+++i++
  SapurV1A.0045s0430.1.p 101 ALTVLQLQELQLQSLIYKYIQAGFPVPFQLVLPIWR 136
                             56777*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166617.312101136IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.4E-9103135IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.381171215IPR014977WRC domain
PfamPF088791.8E-20172212IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKWSLKPHLP NLPVFQTPVC TYSCIFQAFQ SNKSNQPYRS QFFSSFYLLS FTGTRLASGG  60
NVERNMRHGE SGSPPIGLGL ELGRGSGSSQ RPIISCKKHY ALTVLQLQEL QLQSLIYKYI  120
QAGFPVPFQL VLPIWRSVAT SLGGLSSRLL QLYPSLMGCS PLYLEYKNGV DPEIGRCRRT  180
DGKKWRCSKE ALPDQKYCDR HIHRGRQRSR KLEESASPGN SSTNLSISLP GISSASAW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.24e-94hypothetical protein POPTR_0001s08310g
TrEMBLB9GKS45e-94B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-25growth-regulating factor 2