PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0040s0170.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family WOX
Protein Properties Length: 237aa    MW: 27060.3 Da    PI: 7.6586
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0040s0170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.6e-201877357
                            --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                            +R+++tkeq+  Le+++ +  r+ps+e++e+++++l    +++ ++V++WFqN++a++++
  SapurV1A.0040s0170.1.p 18 SRWNPTKEQISMLESFYSQgIRTPSTEMIEQITSRLkaygHIEGKNVFYWFQNHKARQRQ 77
                            7*****************99**************************************97 PP

2Wus_type_Homeobox110.59.1e-361779365
       Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                            ++RW+Pt+eQi +Le+ y++G+rtP++e i++it++L++yG+ie+kNVfyWFQN+kaR+rqkq
  SapurV1A.0040s0170.1.p 17 SSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKARQRQKQ 79
                            79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.7381378IPR001356Homeobox domain
SMARTSM003893.6E-61582IPR001356Homeobox domain
SuperFamilySSF466892.69E-131686IPR009057Homeodomain-like
PfamPF000465.3E-181877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-91877IPR009057Homeodomain-like
CDDcd000867.01E-71979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDSDDMDVAG SVGAPGSSRW NPTKEQISML ESFYSQGIRT PSTEMIEQIT SRLKAYGHIE  60
GKNVFYWFQN HKARQRQKQK QESMAYINNY LHKVHQPVFA PPCANVVCSP YYPQQSEVMR  120
FRQQHPRMLL PANFKMRPRS EARTYAFNGY EPAVPYEYHN RLTMNKGDRT LVTINHKRCS  180
DQETLPLFPL HPTGSFDGAP AENSIDTPGS SEISTVIEEH SGDCKPFFDF FHGKDS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0040s0170.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827020.0KF982702.1 Populus tomentosa WOX2b (WOX2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313442.21e-160WUSCHEL-related homeobox 2
TrEMBLB9HPI91e-158B9HPI9_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03460.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-55WUSCHEL related homeobox 2