PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0038s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 222aa    MW: 24076.6 Da    PI: 7.2168
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0038s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.8e-43681671100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q+
  SapurV1A.0038s0110.1.p  68 PCAACKILRRRCVDKCVLAPYFPPTEPFKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAISQLQKQV 154
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             + l+a+la++++e
  SapurV1A.0038s0110.1.p 155 SDLQAQLAKAQAE 167
                             ********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87967168IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-4368165IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MDMLEKPATM SPINAPSQFS YSPSSSSSPP SSRHSCPSAF PSPSKSNSLG LTSPSAVTPP  60
PPPVVISPCA ACKILRRRCV DKCVLAPYFP PTEPFKFTIA HRVFGASNII KFLQELPESQ  120
RADAVSSMVY EANARIRDPV YGCAGAISQL QKQVSDLQAQ LAKAQAEVVS VQCQQANLVA  180
LLCMEMKQSQ QEPILQQHQY MDTSCFLDEN NLGASWEPLW T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-44601753118LOB family transfactor Ramosa2.1
5ly0_B7e-44601753118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0038s0110.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312035.21e-132LOB domain-containing protein 1
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY21e-131B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-67LOB domain-containing protein 1