PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0032s0720.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family VOZ
Protein Properties Length: 491aa    MW: 54506.1 Da    PI: 5.9632
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0032s0720.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ428.78.4e-1322084242217
                     VOZ   2 ppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                             ppsaflgpkcalwdc+rpaqg  +w+qdycssfh ++alneg+pg++p+lrp+gi+lkdgllf++lsakv+gk+vgipecegaatak
  SapurV1A.0032s0720.6.p 208 PPSAFLGPKCALWDCSRPAQGgLDWFQDYCSSFHHAVALNEGPPGLSPILRPGGIGLKDGLLFSSLSAKVEGKDVGIPECEGAATAK 294
                             7******************9648**************************************************************** PP

                     VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyei 174
                             spwna+elfdls+l+getirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei
  SapurV1A.0032s0720.6.p 295 SPWNAPELFDLSVLKGETIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESRKQVMNEFGGLKRSYYMDPQPLNNFEWHLYEYEI 381
                             *************************************************************************************** PP

                     VOZ 175 neldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                             n++da+alyrlelk vd+kksakgkv+++s+adlqk++grlta
  SapurV1A.0032s0720.6.p 382 NNCDACALYRLELKAVDGKKSAKGKVANESVADLQKQMGRLTA 424
                             *****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MGKGSKINCK SASHKLFKDK AKNRVDDLQG MFLDLQFARK ESRMVDVAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDICRL LQLCEEEDDA TSALAAPKLE PNDQRLQVGN  120
NVVFQEGYGV NHGQQEHVFP FVDQCKASPS GDRSMVINSV EGVAQLEYHD FDLPQNSEQN  180
FYTGFNGMDL GEDATHLVSS YLPSMFLPPS AFLGPKCALW DCSRPAQGGL DWFQDYCSSF  240
HHAVALNEGP PGLSPILRPG GIGLKDGLLF SSLSAKVEGK DVGIPECEGA ATAKSPWNAP  300
ELFDLSVLKG ETIREWLFFD KPRRAFESGN RKQRSLPDYT GRGWHESRKQ VMNEFGGLKR  360
SYYMDPQPLN NFEWHLYEYE INNCDACALY RLELKAVDGK KSAKGKVANE SVADLQKQMG  420
RLTAEFPAEH KRAVKGRTKV NSKASVGNVY SGSTRVAPPT NEAYDNGSGP HYDYLTENLG  480
DYYLTQFKKP *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0032s0720.6.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377435.10.0transcription factor VOZ1 isoform X1
RefseqXP_024437335.10.0transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9N9L20.0B9N9L2_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05890.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]