PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0029s0080.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27630.3 Da    PI: 9.9524
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0029s0080.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF983.9e-312474151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien++nrqvtf+kRr g+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  SapurV1A.0029s0080.2.p 24 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
                            79***********************************************95 PP

2K-box112.44.5e-37921885100
                   K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                             s++  ++e++a+++qqe+akL+++i nLq+++Rh+lGe L+sLs+keL++Le +Lek++++iRskKnell+++ie++qk+e +l+++
  SapurV1A.0029s0080.2.p  92 SNTGsVSETNAQYYQQEAAKLRSQIGNLQNSNRHMLGEALSSLSVKELKSLEIRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNN 178
                             344459********************************************************************************* PP

                   K-box  91 nkaLrkklee 100
                             ++ Lr+k+ e
  SapurV1A.0029s0080.2.p 179 KHLLRAKISE 188
                             *******976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.2631676IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-331791IPR002100Transcription factor, MADS-box
CDDcd002657.44E-441793No hitNo description
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-321838IPR002100Transcription factor, MADS-box
PfamPF003192.5E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-325374IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2799186IPR002487Transcription factor, K-box
PROSITE profilePS5129714.905102192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MAYQNESHES SPLKKLGRGK VEIKRIENTT NRQVTFCKRR SGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYSNDSVKST IERYKKASAD SSNTGSVSET NAQYYQQEAA KLRSQIGNLQ  120
NSNRHMLGEA LSSLSVKELK SLEIRLEKGI SRIRSKKNEL LFAEIEYMQK REVDLHNNKH  180
LLRAKISENE RKRQNMNLMP GGVEFEIMQS QPYDSRSYSQ VNGLPPANHY PHQDQMALQL  240
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-201688173Myocyte-specific enhancer factor 2B
1tqe_Q2e-201688173Myocyte-specific enhancer factor 2B
1tqe_R2e-201688173Myocyte-specific enhancer factor 2B
1tqe_S2e-201688173Myocyte-specific enhancer factor 2B
6c9l_A2e-201688173Myocyte-specific enhancer factor 2B
6c9l_B2e-201688173Myocyte-specific enhancer factor 2B
6c9l_C2e-201688173Myocyte-specific enhancer factor 2B
6c9l_D2e-201688173Myocyte-specific enhancer factor 2B
6c9l_E2e-201688173Myocyte-specific enhancer factor 2B
6c9l_F2e-201688173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0029s0080.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7143860.0JQ714386.1 Populus simonii x Populus nigra isolate A flowering locus C (FLC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009675.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
RefseqXP_011009676.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
RefseqXP_011009678.11e-166PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ408721e-127AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLA0A3Q9HFF81e-164A0A3Q9HFF8_POPAL; AGAMOUS1
STRINGEOY278721e-150(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-116MIKC_MADS family protein