PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0025s0830.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 185aa    MW: 21658.8 Da    PI: 8.8902
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0025s0830.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.72e-25959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            k+ien++nrqvt+skRrn ++KKA+ L vLCd+ev+++++s t+k++ey+s
  SapurV1A.0025s0830.1.p  9 KKIENSTNRQVTYSKRRNDLFKKAHDLTVLCDTEVSLVMVSCTDKVHEYIS 59
                            68***********************************************86 PP

2K-box83.73.9e-2871168198
                   K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                             yq+++g +l++ ++e ++++l+kLk+ + +++re+R+++G++L++Ls+++Lq+Le+++e++ + i ++ n++l++qie+ +kk +++
  SapurV1A.0025s0830.1.p  71 YQQTKGIDLWSCHYEIMKENLEKLKEMNIKIRREIRQRMGQCLNDLSFQDLQSLESDMESAWRVIHDRANRVLTNQIETFKKKVRNV 157
                             78999999******************************************************************************* PP

                   K-box  88 qeenkaLrkkl 98 
                             +++n++L++++
  SapurV1A.0025s0830.1.p 158 EQINRKLKMEV 168
                             *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-34160IPR002100Transcription factor, MADS-box
CDDcd002651.06E-35280No hitNo description
PRINTSPR004041.9E-24323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-34395IPR002100Transcription factor, MADS-box
PfamPF003199.1E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-243859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-1983167IPR002487Transcription factor, K-box
PROSITE profilePS5129714.62284174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MARGKIQIKK IENSTNRQVT YSKRRNDLFK KAHDLTVLCD TEVSLVMVSC TDKVHEYISP  60
SITTKRIFDQ YQQTKGIDLW SCHYEIMKEN LEKLKEMNIK IRREIRQRMG QCLNDLSFQD  120
LQSLESDMES AWRVIHDRAN RVLTNQIETF KKKVRNVEQI NRKLKMEVGA MDEDPYGLVD  180
NGGD*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0025s0830.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386194.11e-121floral homeotic protein DEFICIENS
SwissprotE0CPH45e-86AP3_VITVI; Agamous-like MADS-box protein AP3
TrEMBLU5GNN81e-119U5GNN8_POPTR; Uncharacterized protein
STRINGPOPTR_0002s02990.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-70MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]