PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0024s0300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 817aa    MW: 88870.9 Da    PI: 6.2147
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0024s0300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-21116171156
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  SapurV1A.0024s0300.1.p 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 171
                             688999***********************************************999 PP

2START193.69.2e-613265511206
                             HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                   START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                             ela++a++elvk+a+a+ep+W  s     e++n +e l++f++  +     +  ea+r++g+v+ ++  lve+l+d+  +W e+++ 
  SapurV1A.0024s0300.1.p 326 ELALAAMDELVKMAQADEPLWIGSFeggrEILNHEEHLRSFTPCIGmkpsgFVREASRETGMVIINSLALVETLMDSD-RWAEMFPc 411
                             5899******************9999***************9998899999999************************.******** PP

                             ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEE CS
                   START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgil 153
                                + +t++vi sg      g lqlm aelq+l+plvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +  +++lpSg++
  SapurV1A.0024s0300.1.p 412 miaRTSTTDVIASGmggtrnGSLQLMHAELQVLTPLVPvREVNFLRFCKQHAEGVWAVVDVSIDAIRETSGaPPTFLNCRRLPSGCV 498
                             *****************************************************************9999998999************ PP

                             EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                   START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                             +++++ng+skvtwveh++++++++h+l+r+l++sg+ +ga++w atlqrqce+
  SapurV1A.0024s0300.1.p 499 VQDMPNGYSKVTWVEHAEYDESQVHQLYRPLISSGMGFGAQRWIATLQRQCEC 551
                             ***************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-20102173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-22103173IPR009057Homeodomain-like
PROSITE profilePS5007117.216113173IPR001356Homeobox domain
SMARTSM003891.7E-17114177IPR001356Homeobox domain
CDDcd000862.01E-18115173No hitNo description
PfamPF000462.2E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084843.618317554IPR002913START domain
SuperFamilySSF559618.24E-33319551No hitNo description
CDDcd088751.88E-124321550No hitNo description
SMARTSM002341.9E-43326551IPR002913START domain
PfamPF018521.8E-52326551IPR002913START domain
SuperFamilySSF559613.52E-23580809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MSFGGFLENT SPGGGGGARF VADIPYNNNN NMSTGAIAQT RLVSPSITKS MFNSPGLSLA  60
LQQPNIDGQG DISRMAENFE ASVGRRSREE EHESRSGSDN MDGASGDDQD DNPPRKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSR RLCLETRQVK FWFQNRRTQM KTQLERHENS  180
LLRQDNDKLR AENMSIRDAM RNPSCSNCGG PAIIGDISLE EQHLRIENAR LKDELDRVCA  240
LAGKFLGRPI SSLASPLGPP MPNSSLELAV GSNGFAGMST VATTLPLGPH FEGGISGALP  300
MVTQTRLATA GVPGTDRSLE RSMFLELALA AMDELVKMAQ ADEPLWIGSF EGGREILNHE  360
EHLRSFTPCI GMKPSGFVRE ASRETGMVII NSLALVETLM DSDRWAEMFP CMIARTSTTD  420
VIASGMGGTR NGSLQLMHAE LQVLTPLVPV REVNFLRFCK QHAEGVWAVV DVSIDAIRET  480
SGAPPTFLNC RRLPSGCVVQ DMPNGYSKVT WVEHAEYDES QVHQLYRPLI SSGMGFGAQR  540
WIATLQRQCE CLAILMSSNV PSRDHTAITT SGRRSMLKLA QRMTGNFCAG VCASTVHKWN  600
KLNAGNVDED VRVMTRKSVD DPGEPPGIVL SAATSVWLPV SPQRLFDFLR NERLRSEWDI  660
LSNGGPMQEM AHIAKGQDHG NCVSLLRASA MNASQSSMLI LQETCIDAAG SLVVYAPVDT  720
PAMHVVMNGG DSAYVALLPS GFAIVPDGPQ TTSGDPTTHN NGGGQERVGG SLLTVAFQIL  780
VNSLPTAKLT VESVETVKNL ISCTVQKIKA ALQCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0024s0300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023404.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A385JHT90.0A0A385JHT9_POPTO; Homeodomain protein
TrEMBLB9GPV90.0B9GPV9_POPTR; Uncharacterized protein
STRINGPOPTR_0002s15610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]