PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0023s0430.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family LBD
Protein Properties Length: 218aa    MW: 23718.9 Da    PI: 6.4881
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0023s0430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.2e-43661651100
                  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                             +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q+
  SapurV1A.0023s0430.1.p  66 PCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAISQLQKQV 152
                             7************************************************************************************** PP

                  DUF260  88 eqlkaelallkee 100
                             + l+a+la++++e
  SapurV1A.0023s0430.1.p 153 SDLQAQLAKAQAE 165
                             ********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05865166IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4366163IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDMIEQSAAK SPINAPSQFP YSPSSSSPSY SHHYSPTAYS SPSKSSPNLT PPSAATPPPP  60
PVVVSPCAAC KILRRRCVDK CVLAPYFPPS EPYKFTIAHR VFGASNIIKF LQELPESQRA  120
DAVSSMVYEA NARIRDPVYG CAGAISQLQK QVSDLQAQLA KAQAEVVNMQ CQQANLVALL  180
CMEMTQSQQE PILQQHVDTS CFLDENNLGT SWEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-44581733118LOB family transfactor Ramosa2.1
5ly0_B2e-44581733118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0023s0430.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2841650.0HQ284165.1 Populus tremula x Populus alba lateral organ boundaries domain 1 (LBD1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.11e-127PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLE7DP381e-123E7DP38_POPCN; Lateral organ boundaries domain 1
STRINGPOPTR_0008s04350.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-68LOB domain-containing protein 1