PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0019s1110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27389.3 Da    PI: 9.745
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0019s1110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.4e-281058250
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                            ri+n++ rqvtfskRr g+lKKA+ELS+LCdae+ viifsstgkly+y+
  SapurV1A.0019s1110.1.p 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEIGVIIFSSTGKLYDYA 58
                            8***********************************************8 PP

2K-box84.52.3e-2878171899
                   K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                             +  + +++ + +q+e+a L+ke++ Lq  +R+l+Ge+L+ Ls+k+Lq+Le+qLe slk +R kK+++l+++i++l++k + + +en 
  SapurV1A.0019s1110.1.p  78 QllNPASEVKFWQREAASLRKELHYLQGCHRQLMGEELSGLSVKDLQNLENQLEMSLKGVRIKKDQILTDEIKDLKRKGNLIYQENL 164
                             344678899****************************************************************************** PP

                   K-box  93 aLrkkle 99 
                             +L++k+e
  SapurV1A.0019s1110.1.p 165 ELHNKVE 171
                             ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.385161IPR002100Transcription factor, MADS-box
CDDcd002653.78E-44278No hitNo description
SuperFamilySSF554551.24E-31290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2684170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.25786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007584Biological Processresponse to nutrient
GO:0048527Biological Processlateral root development
GO:0071249Biological Processcellular response to nitrate
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEIGVIIFSS TGKLYDYANT  60
SMRSIIERYN KQKEEHQQLL NPASEVKFWQ REAASLRKEL HYLQGCHRQL MGEELSGLSV  120
KDLQNLENQL EMSLKGVRIK KDQILTDEIK DLKRKGNLIY QENLELHNKV ELVSQENSEL  180
HEVYGKQNVD EVNRVSQAPY TVGNAYDLHA PIRLQLSQPH PHNREALGKS MKLGLQLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-22181181MEF2C
5f28_B1e-22181181MEF2C
5f28_C1e-22181181MEF2C
5f28_D1e-22181181MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0019s1110.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313958.31e-157MADS-box transcription factor 23
RefseqXP_024463960.11e-157MADS-box transcription factor 23
SwissprotQ6EP491e-101MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A3N7FIC21e-155A0A3N7FIC2_POPTR; Uncharacterized protein
STRINGXP_002518331.11e-132(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF8912560
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-98AGAMOUS-like 44
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]